[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99411.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:RPS:PFM   17->62 PF06612 * DUF1146 2e-05 50.0 %
:HMM:PFM   15->62 PF06612 * DUF1146 1.1e-19 54.2 48/48  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99411.1 GT:GENE ABD99411.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 644116..644346 GB:FROM 644116 GB:TO 644346 GB:DIRECTION + GB:PRODUCT Hypothetical membrane spanning protein GB:PROTEIN_ID ABD99411.1 GB:DB_XREF GI:90820772 LENGTH 76 SQ:AASEQ MYLGLMAVVTIISHFFFITLVFISFQGLRLDYFFSKEKQGKFRLALVLFSVAIGYLASEFFLSFIDSIRNLLFLIK GT:EXON 1|1-76:0| TM:NTM 2 TM:REGION 7->29| TM:REGION 47->69| RP:PFM:NREP 1 RP:PFM:REP 17->62|PF06612|2e-05|50.0|46/48|DUF1146| HM:PFM:NREP 1 HM:PFM:REP 15->62|PF06612|1.1e-19|54.2|48/48|DUF1146| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------1-1-------------1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //