[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99415.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->72 PF11184 * DUF2969 3.6e-25 42.3 71/71  
:BLT:SWISS 4->58 EXUR_BACSU 7e-05 36.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99415.1 GT:GENE ABD99415.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 647085..647306 GB:FROM 647085 GB:TO 647306 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99415.1 GB:DB_XREF GI:90820776 LENGTH 73 SQ:AASEQ MSKREKNIEILEVEKIVDNNTITELTTKDQEVIGRILQDGKRYIAELKNGETFRVSSQAEAMEILLREYHLHR GT:EXON 1|1-73:0| BL:SWS:NREP 1 BL:SWS:REP 4->58|EXUR_BACSU|7e-05|36.4|55/100| HM:PFM:NREP 1 HM:PFM:REP 1->72|PF11184|3.6e-25|42.3|71/71|DUF2969| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,8-8,72-74| PSIPRED ccccccccEEEEEEEHHccccEEHHHHcHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccc //