[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99419.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:284 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->144 2sebD PDBj 6e-04 33.9 %
:BLT:PDB   131->188 2vkhC PDBj 9e-05 39.6 %
:RPS:PDB   23->279 3dxqB PDBj 2e-08 13.4 %
:RPS:SCOP  12->262 1zylA1  d.144.1.6 * 2e-06 13.5 %
:HMM:SCOP  82->246 1j7lA_ d.144.1.6 * 9.3e-11 24.7 %
:HMM:PFM   89->228 PF01636 * APH 1.2e-10 18.8 138/238  
:BLT:SWISS 47->217 APLP_DROME 1e-04 31.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99419.1 GT:GENE ABD99419.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 650629..651483 GB:FROM 650629 GB:TO 651483 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99419.1 GB:DB_XREF GI:90820780 LENGTH 284 SQ:AASEQ MDGIDFLIEFLNDYYKAKLKNIHDIAGNVHLSGYSELYKKDLFVKIFSNKDMFYAEQHVNQVYYPEIYLDSVIFEDNYVVVLKDRQLEDTDKKKISKEQAYLYGNLLADFHNKLTGNVSVYEDKSSLGEQIDTLVKTLQNTEYIDDINAVNKTIKERLEKAQLEYELLPRVVLHGDFSIRNIKKYQDQVILIDFERSRIGVAYQDFVKFFFNEVKDLDLRNAFLKGYRENRPFEIPSETLQSVLLFKTALEILNFHLSHPEKKFGRMADDMLVAIREDKGFLEL GT:EXON 1|1-284:0| BL:SWS:NREP 1 BL:SWS:REP 47->217|APLP_DROME|1e-04|31.2|157/3351| BL:PDB:NREP 2 BL:PDB:REP 36->144|2sebD|6e-04|33.9|109/217| BL:PDB:REP 131->188|2vkhC|9e-05|39.6|48/537| RP:PDB:NREP 1 RP:PDB:REP 23->279|3dxqB|2e-08|13.4|246/280| HM:PFM:NREP 1 HM:PFM:REP 89->228|PF01636|1.2e-10|18.8|138/238|APH| RP:SCP:NREP 1 RP:SCP:REP 12->262|1zylA1|2e-06|13.5|245/325|d.144.1.6| HM:SCP:REP 82->246|1j7lA_|9.3e-11|24.7|158/263|d.144.1.6|1/1|Protein kinase-like (PK-like)| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 255 STR:RPRED 89.8 SQ:SECSTR ######################cGGTTccccEEEcEEEETTEEEEEccHHHHHHHHHHHHHTTcccEEEEEEEcTTTccEEcTTcEEcHHHHHHccTTHHHHHHHHHHHHHTEccccccccccHHHHHHHHHHHTTccccccHcTTHHHHHHHHHHHHHHH#HHTcccccEEEcccccGGGEEcEccccEEcccTTcEEcHHH#HHHHHHHHTTccHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHH##### DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccEEEEEEEEEcccEEEEEEcccEEccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccEEEEEEcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccc //