[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99428.1
DDBJ      :             Thiamin pyrophosphokinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  166/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.82.6c.100.1
:220 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->220 3cq9C PDBj 4e-44 46.1 %
:RPS:PDB   7->220 3cq9C PDBj 3e-33 45.6 %
:RPS:SCOP  3->131 1ig0A2  c.100.1.1 * 6e-16 22.7 %
:RPS:SCOP  149->220 1ig3A1  b.82.6.1 * 7e-09 19.4 %
:HMM:SCOP  7->139 1ig3A2 c.100.1.1 * 1.9e-29 38.0 %
:RPS:PFM   24->125 PF04263 * TPK_catalytic 4e-12 41.8 %
:HMM:PFM   19->127 PF04263 * TPK_catalytic 1e-26 38.3 107/123  
:HMM:PFM   150->211 PF04265 * TPK_B1_binding 6.4e-13 25.8 62/68  
:BLT:SWISS 8->220 THIN_BACSU 8e-31 39.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99428.1 GT:GENE ABD99428.1 GT:PRODUCT Thiamin pyrophosphokinase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 661910..662572 GB:FROM 661910 GB:TO 662572 GB:DIRECTION + GB:PRODUCT Thiamin pyrophosphokinase GB:NOTE COG1564 [H] Thiamine pyrophosphokinase GB:PROTEIN_ID ABD99428.1 GB:DB_XREF GI:90820789 LENGTH 220 SQ:AASEQ MMDNEMIINILVGGPCEELPENFWKSSFSEDHWIGADKGAVDLVKHHQSLLFAVGDFDSSSEEEIELVKENVPELITFKPEKDYTDTELSVKLAIDKYHPKKITIYGATGGRIDHLLANIMFVLKPEFRFYADKIKIIDRRNIINFFLPGKYTINKEENFDYLAFIPLEKIKNLNLYDEKYKLNNANYTYPIALASNEFVGDKASFSFESGLLCVIQSKD GT:EXON 1|1-220:0| BL:SWS:NREP 1 BL:SWS:REP 8->220|THIN_BACSU|8e-31|39.1|207/214| SEG 133->147|dkikiidrrniinff| BL:PDB:NREP 1 BL:PDB:REP 7->220|3cq9C|4e-44|46.1|206/209| RP:PDB:NREP 1 RP:PDB:REP 7->220|3cq9C|3e-33|45.6|206/209| RP:PFM:NREP 1 RP:PFM:REP 24->125|PF04263|4e-12|41.8|98/119|TPK_catalytic| HM:PFM:NREP 2 HM:PFM:REP 19->127|PF04263|1e-26|38.3|107/123|TPK_catalytic| HM:PFM:REP 150->211|PF04265|6.4e-13|25.8|62/68|TPK_B1_binding| GO:PFM:NREP 3 GO:PFM GO:0004788|"GO:thiamin diphosphokinase activity"|PF04263|IPR007371| GO:PFM GO:0005524|"GO:ATP binding"|PF04263|IPR007371| GO:PFM GO:0009229|"GO:thiamin diphosphate biosynthetic process"|PF04263|IPR007371| RP:SCP:NREP 2 RP:SCP:REP 3->131|1ig0A2|6e-16|22.7|128/221|c.100.1.1| RP:SCP:REP 149->220|1ig3A1|7e-09|19.4|72/85|b.82.6.1| HM:SCP:REP 7->139|1ig3A2|1.9e-29|38.0|129/169|c.100.1.1|1/1|Thiamin pyrophosphokinase, catalytic domain| OP:NHOMO 167 OP:NHOMOORG 167 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------1--11111111111111111--1111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111-111111111---11----11--111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1-------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 214 STR:RPRED 97.3 SQ:SECSTR ######EEEEEccccGGGccccGGGccGccccEEEETHHHHHHHHTTTccccEEcccccccHHHHHHHHHHTTTcEEEcccccccHHHHHHHHHHHHTcccEEEEEccccccHHHHHHHcTGGGcTTGGGGGGGEEEEETTEEEEEEccEEEEEEccTTccEEEEEEEEEccEEEEccccccEEEEEEcccccEEEEcccTTEEEEEEccccEEEEEEcc DISOP:02AL 1-1| PSIPRED ccccEEEEEEEEcccHHHHHHHHHHccccccEEEEEEHHHHHHHHcccccEEEEEccccccHHHHHHHHHHccEEEEEcccccccHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHccccccEEcccccccEEEEEEccccccEEEcccEEEccccEEEccccEEEEEEEccEEEEEEEccEEEEEEEcc //