[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99438.1
DDBJ      :             Signal recognition particle associated protein
Swiss-Prot:Y628_LACS1   RecName: Full=UPF0122 protein LSL_0628;

Homologs  Archaea  0/68 : Bacteria  179/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.13
:112 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->111 1s7oC PDBj 5e-32 60.0 %
:RPS:SCOP  4->112 1s7oA  a.4.13.3 * 3e-04 56.2 %
:HMM:SCOP  4->109 1s7oA_ a.4.13.3 * 1.5e-30 42.5 %
:RPS:PFM   3->92 PF04297 * UPF0122 2e-20 64.4 %
:HMM:PFM   3->92 PF04297 * UPF0122 8.6e-38 55.6 90/101  
:BLT:SWISS 1->112 Y628_LACS1 1e-61 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99438.1 GT:GENE ABD99438.1 GT:PRODUCT Signal recognition particle associated protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 674348..674686 GB:FROM 674348 GB:TO 674686 GB:DIRECTION + GB:PRODUCT Signal recognition particle associated protein GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABD99438.1 GB:DB_XREF GI:90820799 LENGTH 112 SQ:AASEQ MAIEKTNRINALFDFYEPLLTPKQMTYIGLYYRDDYSLGEIAENYEVSRQAVYDNIRRTEKILEEYESKLHLYRNFQLQSEELDNLLKYVEENYAYDKELLTRINRLESLEE GT:EXON 1|1-112:0| SW:ID Y628_LACS1 SW:DE RecName: Full=UPF0122 protein LSL_0628; SW:GN OrderedLocusNames=LSL_0628; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->112|Y628_LACS1|1e-61|100.0|112/112| BL:PDB:NREP 1 BL:PDB:REP 3->111|1s7oC|5e-32|60.0|105/108| RP:PFM:NREP 1 RP:PFM:REP 3->92|PF04297|2e-20|64.4|90/100|UPF0122| HM:PFM:NREP 1 HM:PFM:REP 3->92|PF04297|8.6e-38|55.6|90/101|UPF0122| RP:SCP:NREP 1 RP:SCP:REP 4->112|1s7oA|3e-04|56.2|105/106|a.4.13.3| HM:SCP:REP 4->109|1s7oA_|1.5e-30|42.5|106/0|a.4.13.3|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 179 OP:NHOMOORG 179 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-111-1111111111111111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-------------1------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 96.4 SQ:SECSTR ##ccccHHHHHHHHHHGGGccHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHH#TTccTTcHHHHHHHHHHHHHH# DISOP:02AL 111-113| PSIPRED ccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcc //