[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99441.1
DDBJ      :             RNA binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  116/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:81 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   39->63 PF00013 * KH_1 1.7e-06 32.0 25/57  
:HMM:PFM   5->37 PF10926 * DUF2800 0.0009 33.3 33/372  
:BLT:SWISS 6->81 Y1910_LISIN 3e-19 53.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99441.1 GT:GENE ABD99441.1 GT:PRODUCT RNA binding protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 676521..676766 GB:FROM 676521 GB:TO 676766 GB:DIRECTION + GB:PRODUCT RNA binding protein GB:NOTE COG1837 [R] Predicted RNA-binding protein (contains KH domain) GB:PROTEIN_ID ABD99441.1 GB:DB_XREF GI:90820802 LENGTH 81 SQ:AASEQ MTETDVKQLILTIVQPLVAEPDEVKIETEQDDYFLNFNLSVSKEDVGRVIGKHGRIAQAIRNIVYGIRLDNNLKVRLNIVD GT:EXON 1|1-81:0| BL:SWS:NREP 1 BL:SWS:REP 6->81|Y1910_LISIN|3e-19|53.9|76/76| HM:PFM:NREP 2 HM:PFM:REP 39->63|PF00013|1.7e-06|32.0|25/57|KH_1| HM:PFM:REP 5->37|PF10926|0.0009|33.3|33/372|DUF2800| OP:NHOMO 116 OP:NHOMOORG 116 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------111--1----------------------------------------------------------------------11111111111111111111111111-111--11111111--------------------1-1-11-1---11111111-------11111111--1111111111111111111111111--111---1---1-1111111-1-11---111-------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-1----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEEEcHHHEEEEEccccHHHHHHHHHHHHHHcccccEEEEEEcc //