[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99451.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:295 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->26 PF07719 * TPR_2 0.00079 39.1 23/34  
:BLT:SWISS 136->189 YJB1_SCHPO 3e-04 44.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99451.1 GT:GENE ABD99451.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 684538..685425 GB:FROM 684538 GB:TO 685425 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99451.1 GB:DB_XREF GI:90820812 LENGTH 295 SQ:AASEQ MSELYFQAEEAYKNKDYTKARKLLEKEYLEKKTFRTNYFLFLVFFKIEDYIAAYETANEYIRQYIIDNEKFKKYQKAAIFAGMNVKLQELSNNIFEYTTESEQKEFDKNQQTLLTDYLNKNSKLELMKQLSYLGIFPLFQQRKILKDAYGLSVDDFFINTKKILIDSNIHPLLKSNILDDYRKLNLEETVQYTDYKNTVKTLDVKKLKEIEEYKIYKKIYKEFKQLPMNDFEKDLKWKEIVLKLMVLYPFNDIEQNLEQNLIYILLCNDEFKVLNEQELAFSKKLEDYIEQWNNL GT:EXON 1|1-295:0| BL:SWS:NREP 1 BL:SWS:REP 136->189|YJB1_SCHPO|3e-04|44.4|54/715| SEG 22->32|kllekeylekk| SEG 205->224|kklkeieeykiykkiykefk| HM:PFM:NREP 1 HM:PFM:REP 4->26|PF07719|0.00079|39.1|23/34|TPR_2| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccEEEEEEccEEEEEEHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcHHHHHHHHHHHHcccHHHHHHHHccEEEEEEEccHHHHccHHHHHHHHHHHHHHHHHccc //