[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99458.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:167 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->64 PF03896 * TRAP_alpha 0.00048 28.6 56/285  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99458.1 GT:GENE ABD99458.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 693623..694126 GB:FROM 693623 GB:TO 694126 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99458.1 GB:DB_XREF GI:90820819 LENGTH 167 SQ:AASEQ MKFWLVILTAIVFIVIIVVIQYYIKNKKLKRLQARSRKLTDDAMYKSINEIDLEWFNQNNHKNIRDIAVVSDVWGKDVMVFEYSVELIQNQKFSSEKLNALKELLEKKLFDYAKQKKIQNMANKPPFIVSDIWQLENILHIDVAYIMNEATYKYLNDIEKLEPGFKK GT:EXON 1|1-167:0| TM:NTM 1 TM:REGION 3->25| SEG 6->20|viltaivfiviivvi| SEG 96->109|eklnalkellekkl| HM:PFM:NREP 1 HM:PFM:REP 3->64|PF03896|0.00048|28.6|56/285|TRAP_alpha| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-----11---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 165-168| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHHcccccccHHHHHHHHHHccccEEEEEEEHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEHHHHHccccEEHHHHHHHHHHHHHHHHHHHHcccccc //