[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99460.1
DDBJ      :             Lactate/malate dehydrogenase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  120/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.162.1
:294 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   68->286 1y6jA PDBj 4e-14 24.8 %
:RPS:PDB   79->289 2d4aD PDBj 3e-16 21.6 %
:RPS:SCOP  121->289 1up4A2  d.162.1.2 * 4e-10 16.1 %
:HMM:SCOP  134->293 1i10A2 d.162.1.1 * 5.5e-16 21.2 %
:RPS:PFM   136->290 PF02866 * Ldh_1_C 6e-07 26.0 %
:HMM:PFM   244->290 PF02866 * Ldh_1_C 7.6e-06 27.7 47/174  
:HMM:PFM   189->265 PF07814 * WAPL 0.00065 13.0 77/361  
:BLT:SWISS 90->292 LDH_MYCCT 5e-15 24.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99460.1 GT:GENE ABD99460.1 GT:PRODUCT Lactate/malate dehydrogenase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 694948..695832 GB:FROM 694948 GB:TO 695832 GB:DIRECTION + GB:PRODUCT Lactate/malate dehydrogenase GB:PROTEIN_ID ABD99460.1 GB:DB_XREF GI:90820821 LENGTH 294 SQ:AASEQ MQKIVYYGYNESVLDFLKIGINNNTKLYFNWQINDTDIQDEINNLVECSRLLSPNFYFYINETVNWDEIDMMLLSIDVDRDNFAQKNSWIQKVVTEAVANGFNGIVVLDSNKDYLLINEILKYTGLSSRQVLGLGTSIESEVVARMVAKKLGINSNYIQTSVIGTRDKSFVLWSKGRVAEASLMSLIVQEKNMFSIKNMQEISKEYKGLAEKTRKLIFSSVLNKILMAMDTSEQFIITLVHSRNEEIESYSSPVLVGKMGVIELIKVNYTEDEQDALNEVKKAINDELDRYKLR GT:EXON 1|1-294:0| BL:SWS:NREP 1 BL:SWS:REP 90->292|LDH_MYCCT|5e-15|24.9|201/317| BL:PDB:NREP 1 BL:PDB:REP 68->286|1y6jA|4e-14|24.8|218/289| RP:PDB:NREP 1 RP:PDB:REP 79->289|2d4aD|3e-16|21.6|204/308| RP:PFM:NREP 1 RP:PFM:REP 136->290|PF02866|6e-07|26.0|154/169|Ldh_1_C| HM:PFM:NREP 2 HM:PFM:REP 244->290|PF02866|7.6e-06|27.7|47/174|Ldh_1_C| HM:PFM:REP 189->265|PF07814|0.00065|13.0|77/361|WAPL| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02866|IPR001236| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02866|IPR001236| RP:SCP:NREP 1 RP:SCP:REP 121->289|1up4A2|4e-10|16.1|168/248|d.162.1.2| HM:SCP:REP 134->293|1i10A2|5.5e-16|21.2|160/0|d.162.1.1|1/1|LDH C-terminal domain-like| OP:NHOMO 131 OP:NHOMOORG 121 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------1----------------------------------------11----11111111-111111------111----1111--121---1111111111111--11--111-22-1---211111-1-1--23311111111111111111111111111111111111111111111----2-----------1------1-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111------------1--1-----11------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 256 STR:RPRED 87.1 SQ:SECSTR ####################################HHHHHGGGccccHHHTccccEEEEccGGGGTTccEEEEcEcccccTcHHHHHHHHHHHHHHHHHcTTcEEEEccccHHHHHHHHHHHHcccGGGEEEccHHHHHHHHHHHHHHHHTccGGGEEccEEcccTTcEEcGGGcEETTEETTTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccEEEEEEEEEEcGcEEEEEEEEEETTEEEEEccccccHHHHHHHHHHHHHHHHHHTHHH## DISOP:02AL 1-1| PSIPRED ccEEEEEEccHHHHHHHHHHcccccEEEEcccccHHHHHHHHHccccccEEccccEEEEccccEEEEccccEEccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHcccHHHEEEcccHHHHHHHHHHHHHHHcccHHHEEEEEEcccccccEEEcccEEccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccEEEEEEEEcccccEEEEcccccHHHHHHHHHHHHHHHHHHHHcccc //