[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99482.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:357 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->323 PF01757 * Acyl_transf_3 2.8e-19 21.2 306/340  
:BLT:SWISS 1->282 YIAH_ECOLI 6e-07 28.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99482.1 GT:GENE ABD99482.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 719767..720840 GB:FROM 719767 GB:TO 720840 GB:DIRECTION + GB:PRODUCT Hypothetical membrane spanning protein GB:PROTEIN_ID ABD99482.1 GB:DB_XREF GI:90820843 LENGTH 357 SQ:AASEQ MKRRNYGIDLLRIVAMYMIVLYHCLLLGGVITKATQIGIGSINYDISWLLDTLCYCAVNCYALISGYVGVKSKFKLQNIIKPWFQVLFYSVVLNIIIWVTIPNVPINKGLLIQMLMPISFERYWYFSAYFILFAFMPFLNLLLNKLDKSMATKLLITLILVCSFGETFIFRAKTFLSLQSGYSAPWLIILYLIGGYIKLYGWKFWKHDKTVYFSMAILSFAVFLLLGGEQSHGRVLINYPAPTMLFMGIALLNIFSKLSLNSRIIQGVKLFAPLTFGVYLIHIHPFVAEYLFKDRFADIALNSPVMFIGKIIIFSLCINLVCSIIELVRAKLFKLLKLNVLADAIAAYIQRHFEKLI GT:EXON 1|1-357:0| BL:SWS:NREP 1 BL:SWS:REP 1->282|YIAH_ECOLI|6e-07|28.0|246/331| TM:NTM 10 TM:REGION 9->31| TM:REGION 48->70| TM:REGION 90->112| TM:REGION 126->148| TM:REGION 150->171| TM:REGION 179->200| TM:REGION 207->228| TM:REGION 240->262| TM:REGION 267->289| TM:REGION 305->327| SEG 187->201|liilyliggyiklyg| HM:PFM:NREP 1 HM:PFM:REP 6->323|PF01757|2.8e-19|21.2|306/340|Acyl_transf_3| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1-------1111111-11---------------------------------1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //