[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99485.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:69 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   4->67 2e5qA PDBj 9e-04 19.2 %
:HMM:PFM   2->43 PF00924 * MS_channel 0.00014 36.4 33/207  
:HMM:PFM   43->60 PF01436 * NHL 0.00033 33.3 18/28  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99485.1 GT:GENE ABD99485.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(723653..723862) GB:FROM 723653 GB:TO 723862 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99485.1 GB:DB_XREF GI:90820846 LENGTH 69 SQ:AASEQ METKFEIGDRVKCKKFASLTHDFIGTIEKIYENSAMVTIVEHDKADSVVVTDFHNRAVVRLSDMKKVAA GT:EXON 1|1-69:0| RP:PDB:NREP 1 RP:PDB:REP 4->67|2e5qA|9e-04|19.2|52/63| HM:PFM:NREP 2 HM:PFM:REP 2->43|PF00924|0.00014|36.4|33/207|MS_channel| HM:PFM:REP 43->60|PF01436|0.00033|33.3|18/28|NHL| OP:NHOMO 9 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1---2211---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 52 STR:RPRED 75.4 SQ:SECSTR ###cccTTcEEEEE#####cTTc#####cEEE##EEEcccccTTcEEEEEETTccEEEEEGGGEEcc## DISOP:02AL 1-2| PSIPRED ccccEEEccEEEcccccccccccEEEEEEEEccEEEEEEEEccccccHHHHHHccEEEEEHHHHHHHcc //