[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99494.1
DDBJ      :             Diphosphomevalonate decarboxylase
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  130/915 : Eukaryota  152/199 : Viruses  0/175   --->[See Alignment]
d.14.1d.58.26
:322 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->312 2hk2A PDBj 2e-66 49.4 %
:RPS:PDB   7->306 3d4jB PDBj 9e-31 27.6 %
:RPS:SCOP  5->170 1fi4A1  d.14.1.5 * 9e-36 27.1 %
:RPS:SCOP  173->317 1fi4A2  d.58.26.2 * 2e-28 22.1 %
:HMM:SCOP  2->180 1fi4A1 d.14.1.5 * 1.8e-42 35.7 %
:HMM:SCOP  171->321 1fi4A2 d.58.26.2 * 7.3e-43 36.4 %
:HMM:PFM   89->136 PF00288 * GHMP_kinases_N 1.3e-11 35.4 48/68  
:HMM:PFM   216->294 PF08544 * GHMP_kinases_C 7.9e-06 28.4 67/82  
:HMM:PFM   34->88 PF03159 * XRN_N 0.00042 25.9 54/237  
:BLT:SWISS 9->316 ERG19_DICDI 1e-31 31.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99494.1 GT:GENE ABD99494.1 GT:PRODUCT Diphosphomevalonate decarboxylase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(733499..734467) GB:FROM 733499 GB:TO 734467 GB:DIRECTION - GB:PRODUCT Diphosphomevalonate decarboxylase GB:NOTE COG3407 [I] Mevalonate pyrophosphate decarboxylase GB:PROTEIN_ID ABD99494.1 GB:DB_XREF GI:90820855 LENGTH 322 SQ:AASEQ MSNHAAARAHTNIALIKYWGKKDTELILPMNNSLSLTLDHFYTDTSVTFDSSYTKDTFILNGKEIPNENVHKFLNIVREKAGISEFAKVNSTNHVPTTAGLASSASAFAALAAAASKASGMNLSRRDLSRLARRGSGSATRSIYGGFVEWQAGDNDLNSYAVPFIENVSWDIKMIAVVINSKPKKITSRAGMQTVVNTSPYYNSWIKEANRSIPLMKEAISKQDFTTMGELAEENAMKMHALNLSAHPHFSYFSPESIQVMNLVEELRSMGIECYYTMDAGPNVKIICLGKDTASITSFLQKNLPNTEVLVSSAGPGVQYLD GT:EXON 1|1-322:0| BL:SWS:NREP 1 BL:SWS:REP 9->316|ERG19_DICDI|1e-31|31.6|304/391| SEG 99->120|aglassasafaalaaaaskasg| SEG 123->142|lsrrdlsrlarrgsgsatrs| BL:PDB:NREP 1 BL:PDB:REP 1->312|2hk2A|2e-66|49.4|312/331| RP:PDB:NREP 1 RP:PDB:REP 7->306|3d4jB|9e-31|27.6|293/368| HM:PFM:NREP 3 HM:PFM:REP 89->136|PF00288|1.3e-11|35.4|48/68|GHMP_kinases_N| HM:PFM:REP 216->294|PF08544|7.9e-06|28.4|67/82|GHMP_kinases_C| HM:PFM:REP 34->88|PF03159|0.00042|25.9|54/237|XRN_N| RP:SCP:NREP 2 RP:SCP:REP 5->170|1fi4A1|9e-36|27.1|166/188|d.14.1.5| RP:SCP:REP 173->317|1fi4A2|2e-28|22.1|145/203|d.58.26.2| HM:SCP:REP 2->180|1fi4A1|1.8e-42|35.7|168/188|d.14.1.5|1/1|Ribosomal protein S5 domain 2-like| HM:SCP:REP 171->321|1fi4A2|7.3e-43|36.4|151/203|d.58.26.2|1/1|GHMP Kinase, C-terminal domain| OP:NHOMO 305 OP:NHOMOORG 292 OP:PATTERN ------1111111111---------------------------------------------------- ------------1-----------1------1----1--------------------------------------------------------------1--11---------------------------------11-----1-----------------------------------------------------------------------------1--111111---11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-------------------------------------------------1------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------1-------------------------------------------------------------------------------------------------111111111----------------------------------------------------------1--------------------------------------11111111--1-------------------------------------- ----111-212-11111111111111111111111111111-11111111-111---11111-11111-11111111-11111111-1-121111211111111111111211111111--11-11-11131-111--1-1-11--111-1--1-1-1111-1111111111211----------22-2121-1-111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 319 STR:RPRED 99.1 SQ:SECSTR ccccEEEEEccEEEEEccccEEETTTTEEcccEEEEEcTTccEEEEEEEcTTccccEEEETTEEEcTTcHHHHHHHHHHHHHHcccEEEEEEEccccTccccHccHHHHHHHHHHHHHHHHTTcccccHHHHHTTcGGGGGGccccEEEEcccccTTcccccEEEEcTTcTEEEEEEEEccccccccHHHHHHHHHHHcHHHHHHHHHTHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHTcccccccccHHHHHHHHHHHHHHHHcccEEEEEcccccEEEEEEHHHHHHHHHHHHHHccccEEEEEcEEcccc### DISOP:02AL 1-3,186-189,191-192| PSIPRED ccEEEEEEEcccEEEEEEcccccHHHccccccccEEEEcccccEEEEEEcccccccEEEEccEEcccHHHHHHHHHHHHHccccccEEEEEEccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccccHHHHccccccccEEEEEccccccccEEEEEEEEccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccEEEEcHHHHHHHHHHHHHHHcccEEEEEEcccccEEEEEEHHHHHHHHHHHHHHcccccEEEccccccccccc //