[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99508.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:61 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->55 PF10324 * 7TM_GPCR_Srw 4.1e-06 31.9 47/318  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99508.1 GT:GENE ABD99508.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 747546..747731 GB:FROM 747546 GB:TO 747731 GB:DIRECTION + GB:PRODUCT Hypothetical membrane spanning protein GB:PROTEIN_ID ABD99508.1 GB:DB_XREF GI:90820869 LENGTH 61 SQ:AASEQ MFKDLIKQFNFWVSIFCFILSFFNLFIFERKYLLLTILILIIGVVDMFNAVMTVRVNKKDK GT:EXON 1|1-61:0| TM:NTM 2 TM:REGION 7->29| TM:REGION 33->55| SEG 33->42|llltililii| HM:PFM:NREP 1 HM:PFM:REP 9->55|PF10324|4.1e-06|31.9|47/318|7TM_GPCR_Srw| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,58-62| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccc //