[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99514.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  258/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:298 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   204->281 2cz4B PDBj 3e-08 9.2 %
:RPS:PFM   110->186 PF02588 * DUF161 1e-08 40.3 %
:RPS:PFM   224->278 PF10035 * DUF2179 8e-10 47.3 %
:HMM:PFM   13->93 PF02588 * DUF161 1.4e-13 26.2 80/82  
:HMM:PFM   111->190 PF02588 * DUF161 5.5e-17 35.0 80/82  
:HMM:PFM   224->278 PF10035 * DUF2179 3.2e-21 49.1 55/55  
:BLT:SWISS 7->284 YPJC_BACSU 4e-62 42.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99514.1 GT:GENE ABD99514.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(750705..751601) GB:FROM 750705 GB:TO 751601 GB:DIRECTION - GB:PRODUCT Hypothetical membrane spanning protein GB:NOTE COG0011 [S] Uncharacterized conserved protein GB:PROTEIN_ID ABD99514.1 GB:DB_XREF GI:90820875 LENGTH 298 SQ:AASEQ MTYQNEKISLKDLIFITIGCSLYAFGLVTVNIANNLAEGGATGITLIIRYWLHIDPAYSIILLNIPLIWIGYRYLGKKALIYTIYGTTMLSIWTWLWQRIPIDINIHHDLFLAGVLAGLIGGTGSGLVYRFGGTTGGTDIVARIFEKKRGIVMGKTLLALDVIVLTCSLSYLDLRQMMYTLLGSYVFAQVVNFIQEGAYAARGVIIITNHPTEIANDIIQKMERGVSYLKIEGAFSGQERKALYCVVSPNELNTLKGYINHHDSEAFVSIFEVSEAMGDGFSFNAPSRSLLKYIKKGG GT:EXON 1|1-298:0| BL:SWS:NREP 1 BL:SWS:REP 7->284|YPJC_BACSU|4e-62|42.4|278/290| TM:NTM 6 TM:REGION 9->31| TM:REGION 44->66| TM:REGION 79->101| TM:REGION 105->127| TM:REGION 150->172| TM:REGION 182->204| RP:PDB:NREP 1 RP:PDB:REP 204->281|2cz4B|3e-08|9.2|76/92| RP:PFM:NREP 2 RP:PFM:REP 110->186|PF02588|1e-08|40.3|77/82|DUF161| RP:PFM:REP 224->278|PF10035|8e-10|47.3|55/55|DUF2179| HM:PFM:NREP 3 HM:PFM:REP 13->93|PF02588|1.4e-13|26.2|80/82|DUF161| HM:PFM:REP 111->190|PF02588|5.5e-17|35.0|80/82|DUF161| HM:PFM:REP 224->278|PF10035|3.2e-21|49.1|55/55|DUF2179| OP:NHOMO 749 OP:NHOMOORG 260 OP:PATTERN ------------------------------------------1------------------------- ------------------------------------------------------------------------------1---------2222-311----1-1---1---111111111111111-----------211-----1-------------------------------------------11-247AAAAAAAA8AAAAAA546646AAA333657955555555511111111111111222134332332-32311--334334414553334444222222222222224444444444444254222333411244333333343415333444521231122-33223111112231111--------------------------------------------------------------------11--1-----------------------------------------------------------------------------------------11-----1-----------------------------2121221112112-------1--------1-1-----------------------------------------------------------------------21----------------------------------1-11--------------------------------------------------------------------------------1----------------------------------------------------------------------111111112-2-------------------------1111111111--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 76 STR:RPRED 25.5 SQ:SECSTR ###########################################################################################################################################################################################################EEEEGGGHHHHHHHHHHTTccccEEEEEcccccccccEEEEEEEEcHH##HHHHHHHHHHHHTTEEEEEEEEETGGGG################# DISOP:02AL 1-5,292-292,298-299| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcHHHEEEEEEEcccHHHHHHHHHHHHcccEEEEEEEEccccccEEEEEEEEcHHHHHHHHHHHHHHccccEEEEEEccEEEcccccccccccHHHHHHHccc //