[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99521.1
DDBJ      :             Transcriptional regulator, MerR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  194/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:153 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->120 3gpvB PDBj 2e-15 41.7 %
:RPS:PDB   4->146 3d70A PDBj 1e-19 16.8 %
:RPS:SCOP  8->109 1jbgA  a.6.1.3 * 1e-17 18.6 %
:HMM:SCOP  8->132 1q06A_ a.6.1.3 * 5.7e-26 32.0 %
:HMM:PFM   9->46 PF00376 * MerR 1.6e-15 44.7 38/38  
:HMM:PFM   59->113 PF09278 * MerR-DNA-bind 1.1e-06 18.2 55/65  
:BLT:SWISS 8->132 Y186_HAEIN 2e-18 35.2 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99521.1 GT:GENE ABD99521.1 GT:PRODUCT Transcriptional regulator, MerR family GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 758214..758675 GB:FROM 758214 GB:TO 758675 GB:DIRECTION + GB:PRODUCT Transcriptional regulator, MerR family GB:NOTE COG0640 [K] Predicted transcriptional regulators GB:PROTEIN_ID ABD99521.1 GB:DB_XREF GI:90820882 LENGTH 153 SQ:AASEQ MKTEEKIYRIGEIAEMFDLSKSTIRFYEEIGLFPNLKRSPGGLRLFSQEEINCIEDVECLKKTGMSLKDIAAYVSWKQEGDSSLLARLNLIRNQRLTLEQNIRNLEKELTKLTHKQWYYEQAVAAGTESIFNGDCEYEYYRAHPDEQQTESEG GT:EXON 1|1-153:0| BL:SWS:NREP 1 BL:SWS:REP 8->132|Y186_HAEIN|2e-18|35.2|125/135| COIL:NAA 35 COIL:NSEG 1 COIL:REGION 82->116| BL:PDB:NREP 1 BL:PDB:REP 8->120|3gpvB|2e-15|41.7|108/111| RP:PDB:NREP 1 RP:PDB:REP 4->146|3d70A|1e-19|16.8|143/276| HM:PFM:NREP 2 HM:PFM:REP 9->46|PF00376|1.6e-15|44.7|38/38|MerR| HM:PFM:REP 59->113|PF09278|1.1e-06|18.2|55/65|MerR-DNA-bind| RP:SCP:NREP 1 RP:SCP:REP 8->109|1jbgA|1e-17|18.6|102/106|a.6.1.3| HM:SCP:REP 8->132|1q06A_|5.7e-26|32.0|125/127|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 285 OP:NHOMOORG 195 OP:PATTERN -------------------------------------------------------------------- ----1-------1-1-----------------111111-1-----1--------------11--1--12122111111--33--------------------------------------------------------1-----1-----11----------1--1--------------------111----211111212-1122313-221221--1--1--244451461--------------1------5-22-211-44--11332--12441-1-----2211111111111--------------11---1111---48---11-11-11122----2-----1---112-----1--1----1--------------1------------------------------------------------1---1-------1-------------1------------------------------------------111111-11111111111111111-------1----------1------1---1111111-----------1-------1-1-1-----1--------------------1--------------------1-1---1111-1--1---1----1---------------------------------------------------------------------------------------------------------------1-------1-1111--------------1--------------1-----------------------1--------------------2---------------------2-------------1------------------2 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------5---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 93.5 SQ:SECSTR ###ccccEEHHHHHHHHTccHHHHHHHHHTTccccEEcTTTccEEEcGGGGGHHHHHHHHHHHTccHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccccEEEEEEccEEEEEEEcTTccTTT####### DISOP:02AL 1-5,148-154| PSIPRED cccccccccHHHHHHHHcccHHHHHHHHHHcccccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcHHHHHHHHcc //