[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99526.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:Y716_LACS1   RecName: Full=UPF0346 protein LSL_0716;

Homologs  Archaea  0/68 : Bacteria  112/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.60.15
:75 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->71 2fj6A PDBj 7e-18 50.7 %
:RPS:SCOP  5->72 2fj6A1  a.60.15.1 * 3e-10 50.0 %
:HMM:SCOP  4->77 2fj6A1 a.60.15.1 * 1.1e-26 62.2 %
:RPS:PFM   27->70 PF06855 * DUF1250 1e-09 65.9 %
:HMM:PFM   26->71 PF06855 * DUF1250 6.2e-24 60.9 46/46  
:HMM:PFM   5->42 PF07104 * DUF1366 0.00014 21.1 38/116  
:BLT:SWISS 1->75 Y716_LACS1 2e-41 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99526.1 GT:GENE ABD99526.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 761972..762199 GB:FROM 761972 GB:TO 762199 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABD99526.1 GB:DB_XREF GI:90820887 LENGTH 75 SQ:AASEQ MSKRQSFYQFLMTERNPDSTDEIAQFANNAFYDQSFPKQADDYDSLSQYLELNGTYLPSMVIFDNAWTKYEEFMS GT:EXON 1|1-75:0| SW:ID Y716_LACS1 SW:DE RecName: Full=UPF0346 protein LSL_0716; SW:GN OrderedLocusNames=LSL_0716; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->75|Y716_LACS1|2e-41|100.0|75/75| BL:PDB:NREP 1 BL:PDB:REP 5->71|2fj6A|7e-18|50.7|67/82| RP:PFM:NREP 1 RP:PFM:REP 27->70|PF06855|1e-09|65.9|44/46|DUF1250| HM:PFM:NREP 2 HM:PFM:REP 26->71|PF06855|6.2e-24|60.9|46/46|DUF1250| HM:PFM:REP 5->42|PF07104|0.00014|21.1|38/116|DUF1366| RP:SCP:NREP 1 RP:SCP:REP 5->72|2fj6A1|3e-10|50.0|68/74|a.60.15.1| HM:SCP:REP 4->77|2fj6A1|1.1e-26|62.2|74/0|a.60.15.1|1/1|YozE-like| OP:NHOMO 112 OP:NHOMOORG 112 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-111111-111--11111-111111--111111---111111111111-1-11--111111111111111111111111111-11-1-11-1111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 70 STR:RPRED 93.3 SQ:SECSTR ####cTHHHHHHTTcccccccHHHHHHHHHHTcTTccTTcccHHHHHHHHHTcHHHHTTHHHHHHHHHHHHHHH# DISOP:02AL 1-3,75-76| PSIPRED ccccHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHc //