[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99527.1
DDBJ      :             GTP-binding protein
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  365/915 : Eukaryota  188/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:285 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->277 1pujA PDBj 3e-59 47.2 %
:RPS:PDB   8->91 3a1tA PDBj 3e-05 21.7 %
:RPS:PDB   126->181 3a1tA PDBj 1e-08 36.4 %
:RPS:SCOP  10->277 1pujA  c.37.1.8 * 5e-41 46.9 %
:HMM:SCOP  10->192 1pujA_ c.37.1.8 * 8.7e-43 34.4 %
:HMM:SCOP  121->264 1yrbA1 c.37.1.10 * 1.5e-07 20.7 %
:RPS:PFM   126->174 PF02421 * FeoB_N 3e-05 47.9 %
:HMM:PFM   132->185 PF01926 * MMR_HSR1 3.9e-14 38.9 54/108  
:HMM:PFM   24->86 PF10662 * PduV-EutP 0.00015 29.0 62/143  
:HMM:PFM   115->148 PF00025 * Arf 5.2e-05 33.3 33/175  
:BLT:SWISS 4->277 RBGA_BACSU 4e-71 48.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99527.1 GT:GENE ABD99527.1 GT:PRODUCT GTP-binding protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 762258..763115 GB:FROM 762258 GB:TO 763115 GB:DIRECTION + GB:PRODUCT GTP-binding protein GB:NOTE COG1160 [R] Predicted GTPases GB:PROTEIN_ID ABD99527.1 GB:DB_XREF GI:90820888 LENGTH 285 SQ:AASEQ MAIIQWFPGHMAKALRQVKENLKSVDIVLELVDARLPESSRNPQLAEVLQDKPSIIVLTKMDLADPAETKRWINYYESMGQPAIAVNSNSGNLKIIEKKIKEILADKLQSRKEKGIQNQKLRAMCIGIPNVGKSTLLNHLVKKNVAQTGNRPGVTKAQQWLKAGKDLQLLDTPGILWPKFEDPLVGKKLALTGAIKDTLYAKDDVALYAVEHFIHTNPDALAQRYRLTQSELEDTTVETLLAITRNMGFKEDYDRASERLIFEIRKGKLGRYTLDKPPVDASPEN GT:EXON 1|1-285:0| BL:SWS:NREP 1 BL:SWS:REP 4->277|RBGA_BACSU|4e-71|48.9|272/282| SEG 94->103|kiiekkikei| BL:PDB:NREP 1 BL:PDB:REP 10->277|1pujA|3e-59|47.2|254/261| RP:PDB:NREP 2 RP:PDB:REP 8->91|3a1tA|3e-05|21.7|84/254| RP:PDB:REP 126->181|3a1tA|1e-08|36.4|55/254| RP:PFM:NREP 1 RP:PFM:REP 126->174|PF02421|3e-05|47.9|48/188|FeoB_N| HM:PFM:NREP 3 HM:PFM:REP 132->185|PF01926|3.9e-14|38.9|54/108|MMR_HSR1| HM:PFM:REP 24->86|PF10662|0.00015|29.0|62/143|PduV-EutP| HM:PFM:REP 115->148|PF00025|5.2e-05|33.3|33/175|Arf| GO:PFM:NREP 4 GO:PFM GO:0005525|"GO:GTP binding"|PF02421|IPR011619| GO:PFM GO:0015093|"GO:ferrous iron transmembrane transporter activity"|PF02421|IPR011619| GO:PFM GO:0015684|"GO:ferrous iron transport"|PF02421|IPR011619| GO:PFM GO:0016021|"GO:integral to membrane"|PF02421|IPR011619| RP:SCP:NREP 1 RP:SCP:REP 10->277|1pujA|5e-41|46.9|254/261|c.37.1.8| HM:SCP:REP 10->192|1pujA_|8.7e-43|34.4|183/273|c.37.1.8|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 121->264|1yrbA1|1.5e-07|20.7|135/0|c.37.1.10|2/2|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 943 OP:NHOMOORG 589 OP:PATTERN ---1111-111111111-111-1------------11111111------1-11-1111111---1--- -------------------------------------------------------------------------------------111----------------------------------------------------------1111111111111111111111111111111111111--------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-121111-21--1---------------------------------------------------------------------------------------------1--------------------1--1------1----------------------------1--------1-1111111111111111111111111---111--1---1--------1-1---111-----1-----------------------------11-1111-1111111111111111111111--------------------------------------------------------------------------------------------------------------1-11----------------------111-1-----------------111111111111111111111111------------------------11111111--111111-11111111111111111111111111111--- 1211241-93312331222233323211123333221333332333333332231232233321223212321332312223332321--1-212111-1132332-452355234422-23325613-EK3-237211242331-112231-42224346233333333635432243R3322244543431231221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 277 STR:RPRED 97.2 SQ:SECSTR ##EEEEEccccGcTTcHHHHHHTTccEEEEEEETTcTTTTccTTcccHHcccEEEEEEEcGGGccHHHHHHHHHHHHTcEEEEEccTTTGGTGGGHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEccTTccHHHHHHHHHTTcEEEEEEcTTccEEEEEEETTEEEEEEEcccccccccccccTTHHHHHHHHccccEEGGGccccTTEEccccTTcHHHHHHTTcHHccccccHHHHHHHHHHHHTccccHHHHHHHHHHHHHTTTTccccccccEE###### DISOP:02AL 112-114,276-286| PSIPRED ccccccccHHHHHHHHHHHHHHHHccEEEEEEccccccccccHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHccccEEEEcccccccccEEEEEEcccEEEEEcccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccEEEcccccccccccc //