[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99531.1
DDBJ      :             Glucose inhibited division protein A
Swiss-Prot:TRMFO_LACS1  RecName: Full=Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase trmFO;         EC=2.1.1.74;AltName: Full=Folate-dependent tRNA (uracil-5-)-methyltransferase;AltName: Full=Folate-dependent tRNA(M-5-U54)-methyltransferase;

Homologs  Archaea  0/68 : Bacteria  542/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
c.3.1c.70.1
:436 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->415 3g5qA PDBj e-120 56.5 %
:RPS:PDB   7->431 3cesC PDBj 8e-84 23.5 %
:RPS:SCOP  5->52 1b4vA1  c.3.1.2 * 8e-07 22.9 %
:RPS:SCOP  47->318 1ezrA  c.70.1.1 * 1e-40 13.4 %
:HMM:SCOP  1->368 1coyA1 c.3.1.2 * 5.8e-26 21.4 %
:RPS:PFM   5->367 PF01134 * GIDA 6e-25 35.8 %
:HMM:PFM   5->367 PF01134 * GIDA 6.2e-114 41.7 338/392  
:BLT:SWISS 1->436 TRMFO_LACS1 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99531.1 GT:GENE ABD99531.1 GT:PRODUCT Glucose inhibited division protein A GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 767139..768449 GB:FROM 767139 GB:TO 768449 GB:DIRECTION + GB:PRODUCT Glucose inhibited division protein A GB:NOTE COG1206 [J] NAD(FAD)-utilizing enzyme possibly involved in translation GB:PROTEIN_ID ABD99531.1 GB:DB_XREF GI:90820892 LENGTH 436 SQ:AASEQ MTASVNVIGAGLAGSEAAWQIANQGVKVRLYEMRPQKLTPAHHNENFAELVCTNSLRANRLTNAAGLLKEEMRTFNSIIMESADKHSVPAGGALAVDRETFSKEVTEKLHNHPNVEIINEEIDEIPEGLTVIATGPLTSDALAKDITKFTGSDGLFFFDAAAPILEKSSLDMDKVYLKSRYDKGEAAYLNAPMTKDEFYNFYNELIKAETAELHDFEDDKFFEGCMPIEEIASRGAQTMLYGPLKPVGLEDPRTGKEPFAVVQLRQDNAAGDLYNIVGFQTHLKWGEQKRVFSMIPGLENARFVRYGVMHRNTFLCSPEVMQATYQTKKRLDLFFAGQMTGVEGYVESAASGLYAGLNAARIAQGKDPVIFPEETMMGAMAHYITHASVKNFQPINANFGIVPKLQERIRNKQERNLKISERAIDRIKKFKNLNFD GT:EXON 1|1-436:0| SW:ID TRMFO_LACS1 SW:DE RecName: Full=Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase trmFO; EC=2.1.1.74;AltName: Full=Folate-dependent tRNA (uracil-5-)-methyltransferase;AltName: Full=Folate-dependent tRNA(M-5-U54)-methyltransferase; SW:GN Name=trmFO; Synonyms=gid; OrderedLocusNames=LSL_0721; SW:KW Complete proteome; Cytoplasm; FAD; Flavoprotein; Methyltransferase;Transferase; tRNA processing. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->436|TRMFO_LACS1|0.0|100.0|436/436| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| SEG 116->127|eiineeideipe| BL:PDB:NREP 1 BL:PDB:REP 5->415|3g5qA|e-120|56.5|395/423| RP:PDB:NREP 1 RP:PDB:REP 7->431|3cesC|8e-84|23.5|374/516| RP:PFM:NREP 1 RP:PFM:REP 5->367|PF01134|6e-25|35.8|335/391|GIDA| HM:PFM:NREP 1 HM:PFM:REP 5->367|PF01134|6.2e-114|41.7|338/392|GIDA| GO:PFM:NREP 2 GO:PFM GO:0008033|"GO:tRNA processing"|PF01134|IPR002218| GO:PFM GO:0050660|"GO:FAD binding"|PF01134|IPR002218| RP:SCP:NREP 2 RP:SCP:REP 5->52|1b4vA1|8e-07|22.9|48/366|c.3.1.2| RP:SCP:REP 47->318|1ezrA|1e-40|13.4|253/312|c.70.1.1| HM:SCP:REP 1->368|1coyA1|5.8e-26|21.4|322/372|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 747 OP:NHOMOORG 569 OP:PATTERN -------------------------------------------------------------------- 122---------------------------------------------------------------------------1111122111---------11---111111-1---------------111-11--11111111-----2222222221122222222122221222222222212111111112222222222222222222222222221112122222222211111111111111111111211112211111111122311---2222221-2212211111111111222222222222212222222211-1-------1----11---1111-1--2--12221212221211211311-12111111-1111111121111211111111112-22122122112121121111111111221112111111111111111----121111---------1--111------------1111121----------11111111111111---111--1111--11111111111-----------------1--12-1-22111222211121112121111121211111111111111111111111111---1111--111--11111-111111111111--1--11--1-----11------------------------------------11--------------------------11-------------11-------------1--111111111111111-----------1----1--111111-111---------111111111111111---------------11----------1-111--211113-2131-11111-4-11-111221221112121- ----1---------------------------------------------1------1-------------------------------11--111----1--111----------1--------------------------------------21----2--------7---1-----1--11-12------1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 436 STR:RPRED 100.0 SQ:SECSTR ccccEEEEcccHHHHHHHHHHHHTTccEEEEcccGGGEEEEccGGGTTccccccEEEcTHHTcTHHHHHHHHHHTTccHHHHHHHHEEGGGcEEEEcHHHHHHHHHHHHTTcTTEEEEEccEEEEEEcEEEEccccccccEEEETTEEEccccHHEEEEEEccEEEGGGccGGGcEEEcccccccccccccccGGGccccEEEEEccccccccccTTccGGGccccccEEEEEccHHHHHTTGGGcccHHHHccccccccEEEEEEccTTccEEEEETccccccHHHHHHHHHTcTTcTTccEEEccEEEEEEEEEcGGGccTTcccccccTEEEcGGGGTcccHHHHHHHHHHHHHHHHHHHTTcccccccTTTcHHHHHHHHHTcccccGcGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccTcccc DISOP:02AL 1-1,436-437| PSIPRED cccEEEEEcccHHHHHHHHHHHHccccEEEEEccHHHcccccccHHHHHccccccccccccccHHHHHHHHHHHcccHHHHHHHHccccccccEEEcHHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHccccccccccccccEEccccccHHHHEEcccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHccccccccccHHccccccccccccccccccccccccccccEEEEEEEEccccccEEEEEcccccccHHHHHHHHHHcccHHccEEEcccEEEEEcccccHHHccHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHccccccccccccccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccc //