[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99535.1
DDBJ      :             Hypothetical ABC transporter permease protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:534 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   372->408 PF08412 * Ion_trans_N 0.001 29.7 37/77  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99535.1 GT:GENE ABD99535.1 GT:PRODUCT Hypothetical ABC transporter permease protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 771706..773310 GB:FROM 771706 GB:TO 773310 GB:DIRECTION + GB:PRODUCT Hypothetical ABC transporter permease protein GB:NOTE COG3559 [M] Putative exporter of polyketide antibiotics GB:PROTEIN_ID ABD99535.1 GB:DB_XREF GI:90820896 LENGTH 534 SQ:AASEQ MKRRFTHTFMLLIFQLRQKWLWLCLWLIGITAFASGYVSAFEKIAEDQGKVGLFITMKNPAMAAIVGPLPVKFANQYSVGVMYGHEMTLFIAVITMIIAGSFMIDQTRKMEENGQLEILKSLHIGSQASSMATNLLVLLHTVLTIILVSGILVSYNVSSIDLKGSLYFACSLGLASLLGASIAYLCAQIFATSSQARGIFFGIVGILYVLRAGTDVSNLILSKFNPLAWTYLGHPFYQNDWYYLIGLFLLTLILFSIGLTLESLRDLGSSTIASKKGKIKASKWLATPLGFFFYLNRSTIISWLLADGVIALMYGSIYGDIDTFVSSNKLISQMFANNSTTLINSFTSLIIVVTTAIGLVMPLVVVHKVQSETNKERLGYLLVQRVSRLKVYYSSLILALFFGTLAILINGFCLGIAATSSMQANNGKFITTCIKASLNQWPLVCLFVGLMLLSLSLPIFVGWLVYGLLGYSFCVTYFAVLLDLPKWMTHTSLFNVLAKMPMEKFDLMSFAILTDIGILAMLLGGILYTRKEIV GT:EXON 1|1-534:0| TM:NTM 12 TM:REGION 21->43| TM:REGION 85->107| TM:REGION 133->155| TM:REGION 168->190| TM:REGION 201->223| TM:REGION 243->265| TM:REGION 297->319| TM:REGION 346->368| TM:REGION 396->418| TM:REGION 442->464| TM:REGION 472->494| TM:REGION 506->528| SEG 135->148|llvllhtvltiilv| SEG 171->181|slglasllgas| SEG 244->261|liglflltlilfsigltl| SEG 268->283|gsstiaskkgkikask| SEG 443->457|lvclfvglmllslsl| SEG 516->527|igilamllggil| HM:PFM:NREP 1 HM:PFM:REP 372->408|PF08412|0.001|29.7|37/77|Ion_trans_N| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- -------1---------11-1---1-11111------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1-------------------------1------1-11---------11-1---1111-----------------------------1-------------------------------------1----------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,274-278,282-282| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccHHccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHcccHHHHHHHHccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHEEEcccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //