[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99544.1
DDBJ      :             Hypohetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:145 amino acids
:PSIPRED
:HMM:PFM   54->115 PF08842 * DUF1812 0.0006 29.8 57/295  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99544.1 GT:GENE ABD99544.1 GT:PRODUCT Hypohetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 782443..782880 GB:FROM 782443 GB:TO 782880 GB:DIRECTION + GB:PRODUCT Hypohetical protein, phage associated GB:PROTEIN_ID ABD99544.1 GB:DB_XREF GI:90820905 LENGTH 145 SQ:AASEQ MYWILTTVLNYEIALSIVLVLLFDVVGTILIIAPLAKGIDYVINIIRRIFGQSYAENRETRDYIFNTNKIQTLFVFDFDNNLITCGYLDYQQSGDNNYFDLALIPLDAPENQYSFEQVVEETSKHKDSRILVDFEKKIKIYILRY GT:EXON 1|1-145:0| TM:NTM 2 TM:REGION 1->23| TM:REGION 25->46| HM:PFM:NREP 1 HM:PFM:REP 54->115|PF08842|0.0006|29.8|57/295|DUF1812| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccEEEEEEEEccccEEEEEEEEHHHcccccEEEEEEEEcccccccccHHHHHHHHHcccccEEEEEEccEEEEEEEEc //