[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99545.1
DDBJ      :             Hypohetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:58 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99545.1 GT:GENE ABD99545.1 GT:PRODUCT Hypohetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(782877..783053) GB:FROM 782877 GB:TO 783053 GB:DIRECTION - GB:PRODUCT Hypohetical protein, phage associated GB:PROTEIN_ID ABD99545.1 GB:DB_XREF GI:90820906 LENGTH 58 SQ:AASEQ MKFKDHNLARIDGFKTKKGEPDKNNSKPTHIFSGNRAVRIPERGKGPAPAPKPVKKDS GT:EXON 1|1-58:0| SEG 44->56|gkgpapapkpvkk| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,15-29,42-59| PSIPRED cccccccEEEEcccccccccccccccccEEEEcccEEEEccccccccccccccccccc //