Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99548.1
DDBJ      :             Hypothetical protein, phage associated

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:HMM:PFM   3->77 PF05478 * Prominin 0.0003 23.3 73/809  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99548.1 GT:GENE ABD99548.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(783816..784106) GB:FROM 783816 GB:TO 784106 GB:DIRECTION - GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99548.1 GB:DB_XREF GI:90820909 LENGTH 96 SQ:AASEQ MRKFNITDINQLSKNERKSLAYLAKRNLNKLSPDIYKQVEDITTQIAGNRLMLLGLGLQGSTQSLTPSYLAAILEQNWILIRQNEQIIELLKNNNH GT:EXON 1|1-96:0| SEG 53->66|llglglqgstqslt| HM:PFM:NREP 1 HM:PFM:REP 3->77|PF05478|0.0003|23.3|73/809|Prominin| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,94-97| PSIPRED cccccHHHHHHHcHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccEEEEEEEccccccccccHHHHHHHHHccEEEEEccHHHHHHHHHccc //