[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99549.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:50 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   18->44 PF10668 * Phage_terminase 8.8e-05 14.8 27/60  
:HMM:PFM   5->28 PF04041 * DUF377 0.0006 29.2 24/312  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99549.1 GT:GENE ABD99549.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(784134..784286) GB:FROM 784134 GB:TO 784286 GB:DIRECTION - GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99549.1 GB:DB_XREF GI:90820910 LENGTH 50 SQ:AASEQ MTRMCLIDNEKIGMMTNSFKTKDGNVLCVKHAEALGLPPKDVSESSTSDI GT:EXON 1|1-50:0| HM:PFM:NREP 2 HM:PFM:REP 18->44|PF10668|8.8e-05|14.8|27/60|Phage_terminase| HM:PFM:REP 5->28|PF04041|0.0006|29.2|24/312|DUF377| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,42-51| PSIPRED ccEEEEEcccEEEEEEccEEcccccEEEEEEcHHccccHHHccccccccc //