[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99558.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   19->93 PF05595 * DUF771 1e-07 38.9 %
:HMM:PFM   5->98 PF05595 * DUF771 5e-30 37.9 87/91  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99558.1 GT:GENE ABD99558.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 787204..787515 GB:FROM 787204 GB:TO 787515 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99558.1 GB:DB_XREF GI:90820919 LENGTH 103 SQ:AASEQ MEALQVNINHNYLNDVINQIFKTSLEGVTWDINEFRKHCCSNKSAEWVRRYVILPFANEIDFDKGGWCLNPHGGKGKKQMIFAKSACEWMEENKRRIDWKGRV GT:EXON 1|1-103:0| RP:PFM:NREP 1 RP:PFM:REP 19->93|PF05595|1e-07|38.9|72/90|DUF771| HM:PFM:NREP 1 HM:PFM:REP 5->98|PF05595|5e-30|37.9|87/91|DUF771| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,102-104| PSIPRED cccEEEEccHHHHHHHHHHHHHHHccccEEcHHHHHHHHcccccHHHEEEEEEEccccccccccccEEEccccccccEEEEEEHHHHHHHHHccccccccccc //