[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99561.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:195 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   27->85 PF09899 * DUF2126 0.00082 23.7 59/819  
:BLT:SWISS 130->184 TEN3_DANRE 1e-04 29.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99561.1 GT:GENE ABD99561.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 788013..788600 GB:FROM 788013 GB:TO 788600 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99561.1 GB:DB_XREF GI:90820922 LENGTH 195 SQ:AASEQ MIGIKNFKSHANKLKKLNKRFNQWTEYVTEDSFVYGYGGCLVKIHSNLDQKIKDDKKQDFVEKLFKENQDKKETFVLPVKPIKQMFQSINHQCKIAKISFKENIMIIRPDVYGVFDNAKYHFNSYYSIPNIEFATNTKMIESLFVMLYNEQITDIQVGYDNSLKPIYFSNDELEVLASPYRLPGFGDENHVIGSI GT:EXON 1|1-195:0| BL:SWS:NREP 1 BL:SWS:REP 130->184|TEN3_DANRE|1e-04|29.1|55/2590| SEG 49->59|dqkikddkkqd| HM:PFM:NREP 1 HM:PFM:REP 27->85|PF09899|0.00082|23.7|59/819|DUF2126| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,4-4,6-7| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccEEEEEEHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEHHHHHHHHHHcccEEEEEEEEEcccEEEEccccEEEEccccEEccccccccccEEcccHHHHHHHHHHHHccccEEEEEEccccccEEEEccccEEEEccccccccccccccEEccc //