[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99570.1
DDBJ      :             Phage DNA primase
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  82/915 : Eukaryota  0/199 : Viruses  7/175   --->[See Alignment]
a.4.5c.37.1
:289 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   48->241 2csbA PDBj 6e-04 14.2 %
:RPS:PDB   223->268 1dp7P PDBj 3e-05 26.1 %
:RPS:SCOP  17->164 1s9hA  c.37.1.20 * 2e-07 11.9 %
:RPS:SCOP  223->268 1dp7P  a.4.5.20 * 1e-05 26.1 %
:HMM:SCOP  19->188 1tueA_ c.37.1.20 * 1e-13 22.1 %
:HMM:SCOP  217->291 1dp7P_ a.4.5.20 * 0.00042 24.0 %
:HMM:PFM   214->269 PF03288 * Pox_D5 4.6e-10 23.2 56/86  
:HMM:PFM   48->111 PF02510 * SPAN 0.00076 32.8 64/336  
:BLT:SWISS 27->157 YL207_MIMIV 4e-08 31.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99570.1 GT:GENE ABD99570.1 GT:PRODUCT Phage DNA primase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 795859..796728 GB:FROM 795859 GB:TO 796728 GB:DIRECTION + GB:PRODUCT Phage DNA primase GB:NOTE COG0433 [R] Predicted ATPase GB:PROTEIN_ID ABD99570.1 GB:DB_XREF GI:90820931 LENGTH 289 SQ:AASEQ MDKLACHQRDLVNLLYEIIAYTFYRRNELGKFFILTGSGANGKSTYLDMIRTLLGSKNISSLDVSELDQRFKTGELAGKLANIGDDISDSYIKDTSILKKLVTGEAVTAERKGLDPFMFENYSKLLFSANSIPRLGKGSDTKALNRRMVIVPFNATFSPKDPDYKPYIKYDLRQENAIKYLIVKSIEALHRILENNGFTKSELADRELEKYEYENNPILGFFDDLEETDYLNQPTKDVYKLYTEYCLRNGLNSVSNISFSRQITSHFNLTSKSSRVNGKVIRIYIKEEE GT:EXON 1|1-289:0| BL:SWS:NREP 1 BL:SWS:REP 27->157|YL207_MIMIV|4e-08|31.0|129/960| RP:PDB:NREP 2 RP:PDB:REP 48->241|2csbA|6e-04|14.2|190/511| RP:PDB:REP 223->268|1dp7P|3e-05|26.1|46/76| HM:PFM:NREP 2 HM:PFM:REP 214->269|PF03288|4.6e-10|23.2|56/86|Pox_D5| HM:PFM:REP 48->111|PF02510|0.00076|32.8|64/336|SPAN| RP:SCP:NREP 2 RP:SCP:REP 17->164|1s9hA|2e-07|11.9|143/268|c.37.1.20| RP:SCP:REP 223->268|1dp7P|1e-05|26.1|46/76|a.4.5.20| HM:SCP:REP 19->188|1tueA_|1e-13|22.1|163/205|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 217->291|1dp7P_|0.00042|24.0|75/76|a.4.5.20|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 126 OP:NHOMOORG 97 OP:PATTERN --------1-----12---------1--1---------------1--1----1--------------- --------11-----------------------------------------------------1--------------------------------------1---------------------------1------------1---12------------------------------------------31--------------1-------------21--1---11-----1-----1----11--221----1-11---111--13-1--113-2---1---------1--2--1-3131-231222-111-11111-----------1--1--331-----1-----1---1------------------------------1--------------------------------------------------------------------------------------------------------------------11------------------------1-----------------------------------------11----2111-------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2111------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------1-------------1----------1------------------1111------------------------------------------ STR:NPRED 216 STR:RPRED 74.7 SQ:SECSTR ################################################HTTccHHHHHHHcTTccHHHHHHHcHHHHHHHHcccHHHHHHHHHHHccHHHHHTccHHHHHHHHHTcccHHHHHHHHHHHHHHHTcTTccHHHH##HHHHHHHccHHHHHHHHHTTcHHHHHTcTTccHHHHH##HHcTTHHHHHTcTTccHHHHHHHHHHHTcHHHHHTccHHHEEEEEEEEEEHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHcT##################### DISOP:02AL 289-290| PSIPRED ccccccccHHHHHHHHHHHHHHHccccHHEEEEEEEEcccccHHHHHHHHHHHHcccccccccHHHHcccccHHHHcccEEEEEccccccccccHHHHHHHHcccEEEEEEcccccEEEEEEEEEEEEcccccccccccccccEEEEEEEEEccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHccccEEEEHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccEEEEEEEEccc //