[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99574.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.4.1
:203 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   79->176 1a73A PDBj 4e-05 6.4 %
:RPS:SCOP  71->164 1u3eM1  d.4.1.3 * 2e-09 18.5 %
:HMM:SCOP  105->174 1u3eM1 d.4.1.3 * 2.5e-08 29.9 %
:BLT:SWISS 102->161 Y53_BPT3 8e-06 37.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99574.1 GT:GENE ABD99574.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 797586..798197 GB:FROM 797586 GB:TO 798197 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99574.1 GB:DB_XREF GI:90820935 LENGTH 203 SQ:AASEQ MRIKLNPKIINWLEENVPGRPWKETFRMFKQEFPDLEWSLDSMKHSCYRRGIRNEIDSRYKKGHKSWCAGMKGLRIPGSEKGWFNEGRRPPNERPLGSERKYGKYTLVKVKRDGSKYEKWKPKQVHIWEQHNGPLPKGYIITFIDGDKSNLNIDNLACIKKSVNGAMNIKSLRSESPELFKVRVAQIELDQKIKKITKNLGSD GT:EXON 1|1-203:0| BL:SWS:NREP 1 BL:SWS:REP 102->161|Y53_BPT3|8e-06|37.0|54/101| RP:PDB:NREP 1 RP:PDB:REP 79->176|1a73A|4e-05|6.4|94/162| RP:SCP:NREP 1 RP:SCP:REP 71->164|1u3eM1|2e-09|18.5|92/105|d.4.1.3| HM:SCP:REP 105->174|1u3eM1|2.5e-08|29.9|67/105|d.4.1.3|1/1|His-Me finger endonucleases| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------1-------------------------1------------1----------------------------------------------------1----------1-----------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------1-------------------------------------------------1-------------1-----------------------------------------------------------------------------------------------------------------------------------------------------11---------1--------------------------1---------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 46.3 SQ:SECSTR ##############################################################################EEEEEEcccccccccTTEEEEETTEEEEEEEETTEE####EEEETTTGGGTTccEETTEEEEEEETTccTTcccGGGEEEEEHHHHHHGGGcccTTTT########################### DISOP:02AL 1-3,85-85,199-204| PSIPRED cccccccHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccccHHHccccccccccccHHHHccccccccccccEEEEcccEEEEEEEcccccccccHHHHHHHHHHHHcccccccEEEEccccccccccHHEEEEHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccc //