[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99578.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->84 PF00350 * Dynamin_N 0.00025 22.8 57/168  
:PROS 1->67|PS00430|TONB_DEPENDENT_REC_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99578.1 GT:GENE ABD99578.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 800204..800512 GB:FROM 800204 GB:TO 800512 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99578.1 GB:DB_XREF GI:90820939 LENGTH 102 SQ:AASEQ MNENMKSMIKDLKNEFPKIYDRVNHGLYILAIDENGKVYEDEPGFDEKIVEEIQIIYNGNTVSVYPNYIYKCSIRFFVVRYEDLDIITKAVAIVGKHLRKIG GT:EXON 1|1-102:0| PROS 1->67|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| HM:PFM:NREP 1 HM:PFM:REP 19->84|PF00350|0.00025|22.8|57/168|Dynamin_N| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-9,102-103| PSIPRED cccHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccEEccccccHHHHHHHHHEEEEccEEEEcccEEEEEEEEEEEEEEccHHHHHHHHHHHHHHHHHcc //