[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99579.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99579.1 GT:GENE ABD99579.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 800529..800840 GB:FROM 800529 GB:TO 800840 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99579.1 GB:DB_XREF GI:90820940 LENGTH 103 SQ:AASEQ MNENFLSMFKELNRKYPDDYGSIEGLRIDAVDLKGNYDDDDKFDETLLDKLRIYYKEQIITITRYDRDNWEIEDYAYLKFEDFREIGKILSIVMKHISRIELD GT:EXON 1|1-103:0| SEG 38->51|ddddkfdetlldkl| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,103-104| PSIPRED ccHHHHHHHHHHHHHccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHEEEEEEEEcccccEEccEEEEEHHHHHHHHHHHHHHHHHHHHcccc //