[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99580.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->31 PF04670 * Gtr1_RagA 0.0006 37.9 29/231  
:HMM:PFM   25->81 PF00238 * Ribosomal_L14 0.00079 17.9 56/122  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99580.1 GT:GENE ABD99580.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 800941..801201 GB:FROM 800941 GB:TO 801201 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99580.1 GB:DB_XREF GI:90820941 LENGTH 86 SQ:AASEQ MYQELDLNIYDCNGKDYFIDDEFQEKIFRNMFINYKTNIVDIRRNNYSLFDINTDILIEQEDLAVIGKVISIVVKHLSKIDFEESN GT:EXON 1|1-86:0| HM:PFM:NREP 2 HM:PFM:REP 3->31|PF04670|0.0006|37.9|29/231|Gtr1_RagA| HM:PFM:REP 25->81|PF00238|0.00079|17.9|56/122|Ribosomal_L14| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,82-87| PSIPRED ccccccEEEEEccccEEEEcHHHHHHHHHHHHHcccccEEEEEEccEEEEEEccHHEEEHHHHHHHHHHHHHHHHHHHHccccccc //