[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99584.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:72 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   56->69 PF09811 * Yae1_N 0.00016 50.0 14/39  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99584.1 GT:GENE ABD99584.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 801954..802172 GB:FROM 801954 GB:TO 802172 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99584.1 GB:DB_XREF GI:90820945 LENGTH 72 SQ:AASEQ MNRRKSPRQKELELRWVKTLNQNAPGTENSILNLWKNNQVPITELIDFRNLYVSKGYRSGYREGYDEGYFEA GT:EXON 1|1-72:0| HM:PFM:NREP 1 HM:PFM:REP 56->69|PF09811|0.00016|50.0|14/39|Yae1_N| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12,67-67,72-73| PSIPRED cccccccHHHHHHHHHHHHHccccccccHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHcccccc //