[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99587.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:95 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   41->79 PF07603 * DUF1566 0.00017 30.8 26/62  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99587.1 GT:GENE ABD99587.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 803086..803373 GB:FROM 803086 GB:TO 803373 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99587.1 GB:DB_XREF GI:90820948 LENGTH 95 SQ:AASEQ MINKTDYYKYKGKVFFNVEDPFGYKHREVEVLAIYENTAAVRDVKTGLTWTIRKREIGLKETGKLHKHHGHFDYRKTKRQWKGKQEQLIDTIRSL GT:EXON 1|1-95:0| HM:PFM:NREP 1 HM:PFM:REP 41->79|PF07603|0.00017|30.8|26/62|DUF1566| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccccccEEEccEEEEEEccccccccEEEEEEEEEEccHHHEEcccccEEEEEEEEEcHHHHcHHHHHcccccHHHHHHHcccHHHHHHHHHHcc //