[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99588.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   10->104 1b0nA PDBj 5e-04 15.8 %
:HMM:PFM   22->76 PF02879 * PGM_PMM_II 0.0002 29.8 47/105  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99588.1 GT:GENE ABD99588.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 803386..803703 GB:FROM 803386 GB:TO 803703 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99588.1 GB:DB_XREF GI:90820949 LENGTH 105 SQ:AASEQ MYKSRPITVVVNENINYILNREKITKESLYKEVGHQKIIYNPSANTSIQKLEEIAKFLGTNVPDLVTDWKDGSYPDEHEEYDRGYKDGRKDALKELYDKEVNKIG GT:EXON 1|1-105:0| RP:PDB:NREP 1 RP:PDB:REP 10->104|1b0nA|5e-04|15.8|95/103| HM:PFM:NREP 1 HM:PFM:REP 22->76|PF02879|0.0002|29.8|47/105|PGM_PMM_II| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 90.5 SQ:SECSTR #########ccHHHHHHHHHHTTccHHHHHHHHTcHHHHTTccccccHHHHHHHHHHHTccHHHHHccTTccccHHHHHHHHHHHHccccHHHHHHHHHHHHHH# DISOP:02AL 1-3,105-106| PSIPRED ccccccEEEEEEcccHHHHHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //