[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99592.1
DDBJ      :             Phage Terminase Small Subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:150 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   53->138 PF05119 * Terminase_4 6e-09 41.9 %
:HMM:PFM   52->146 PF05119 * Terminase_4 7.7e-27 41.1 95/100  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99592.1 GT:GENE ABD99592.1 GT:PRODUCT Phage Terminase Small Subunit GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 805701..806153 GB:FROM 805701 GB:TO 806153 GB:DIRECTION + GB:PRODUCT Phage Terminase Small Subunit GB:NOTE COG3728 [L] Phage terminase, small subunit GB:PROTEIN_ID ABD99592.1 GB:DB_XREF GI:90820953 LENGTH 150 SQ:AASEQ MPQVAKSAMMHLYEGNPNNLTKKEIYKRKKNEEKLKVSSNNLNPPSWLEPGAKKNFKRIVELMEPTGILSEVDVDILAVYCDTYYDYLSYKRKIRKTGNLIEGKVNPLIREKRNAAAALTKYANMLGLTPSARASLAIHLDDESDDDDDF GT:EXON 1|1-150:0| SEG 141->149|ddesddddd| RP:PFM:NREP 1 RP:PFM:REP 53->138|PF05119|6e-09|41.9|86/99|Terminase_4| HM:PFM:NREP 1 HM:PFM:REP 52->146|PF05119|7.7e-27|41.1|95/100|Terminase_4| OP:NHOMO 23 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1--1-11---------------------------------------------1-------1112-1--------1-----------------------1---------------------1----12---1---11---------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,18-38,143-151| PSIPRED ccccccccHHEHHccccccccHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccc //