[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99602.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:129 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 15->102 HIS1_LISMO 6e-04 25.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99602.1 GT:GENE ABD99602.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 813285..813674 GB:FROM 813285 GB:TO 813674 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99602.1 GB:DB_XREF GI:90820963 LENGTH 129 SQ:AASEQ MISIKLYDSETDKVNYYEQRKINFGKIKKILDFNKDIEEKSARLRILEDKLTNGVVLTKSEEKEFVNLSGENEVYMLEPMIDIVVDLFNNPNVTKEAIYNGLDLQDGVKTLRNIMSDAMGGANKDNSKK GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 15->102|HIS1_LISMO|6e-04|25.9|85/213| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,118-130| PSIPRED cEEEEEEccccccccHHHHHcccHHHHHHHHHccHHHHHHHHHHHHHHHcccccEEEEEcccEEEEccccccEEEEEcHHHHHHHHHHccccccHHHHHccccHHHHHHHHHHHHHHHHcccccccccc //