[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99606.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
b.84.3d.41.3
:616 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->99 3gs9A PDBj 2e-05 32.8 %
:RPS:PDB   166->239 1a6dA PDBj 8e-04 21.4 %
:RPS:PDB   315->432 1brwA PDBj 1e-12 13.3 %
:RPS:SCOP  334->431 1brwA3  d.41.3.1 * 8e-13 14.9 %
:HMM:SCOP  315->431 1qwyA_ b.84.3.2 * 1.3e-11 37.3 %
:RPS:PFM   37->100,164->271,454->575 PF06605 * DUF1142 3e-16 37.0 %
:RPS:PFM   320->394 PF01551 * Peptidase_M23 1e-08 47.8 %
:HMM:PFM   29->572 PF06605 * DUF1142 5.3e-67 26.9 309/327  
:PROS 1->88|PS00430|TONB_DEPENDENT_REC_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99606.1 GT:GENE ABD99606.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 818514..820364 GB:FROM 818514 GB:TO 820364 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99606.1 GB:DB_XREF GI:90820967 LENGTH 616 SQ:AASEQ MFQGKILVQGVNRAEKEPLNLFDPKSVQIQWEVNQTWSLQLTAYNDGSLAYQMLESEASIFLDNQEYIIKQVADDSSSGLDSVQVTATHVYFEVQKIRKYKDYVDPTDKDKQTDVKVLKTDSTKSDDSDNTKTDTNEKTEGNTTTKITTKTTDETQQDNQNQVTYSIQDVLDHWLKDNKLGFTYEVIGSFEKKELEELKDGTGADMLSKISDTWNNAIIYPDNRKIRVYLADKFNLNRGNRIDYLNNANEIKFSTDSTSLTNMVYCIGGKYSVETTTETTTTTTTTTTSGGWGWPFPDVGEGNFMQVQRFGYDGGYRQNGFHDGLDFGSVDHPGRDVHAIHGGKVTIKSYMGGLGNYVVISGGGYNVVYQEAFSSASNIIVNVGDTVKVGDVIGYRDTNHLHVGVTKVDFNVAVGKSFTNDGTWLDPLELIKNGPSDTDTETSSETNSNSNTQEYYYFAPFIYRDEESIKKYGEHPAEPIEDGRFKDKNAMIEYVKTKLQPEPSLSIDVTTTTDIKPIAGDVIHVMVKSQNISTNFTLTGFTWYPYSYTVDNPTSITLNSNVQNILDYQNSRQRQFSKAISKLKGSTNEIVNNINNFNEYGGNQQLQTWLNDFVGG GT:EXON 1|1-616:0| PROS 1->88|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| SEG 119->155|ktdstksddsdntktdtnektegntttkittkttdet| SEG 274->288|etttetttttttttt| SEG 436->452|sdtdtetssetnsnsnt| SEG 588->603|neivnninnfneyggn| BL:PDB:NREP 1 BL:PDB:REP 31->99|3gs9A|2e-05|32.8|61/300| RP:PDB:NREP 2 RP:PDB:REP 166->239|1a6dA|8e-04|21.4|70/503| RP:PDB:REP 315->432|1brwA|1e-12|13.3|113/433| RP:PFM:NREP 2 RP:PFM:REP 37->100,164->271,454->575|PF06605|3e-16|37.0|287/318|DUF1142| RP:PFM:REP 320->394|PF01551|1e-08|47.8|69/96|Peptidase_M23| HM:PFM:NREP 1 HM:PFM:REP 29->572|PF06605|5.3e-67|26.9|309/327|DUF1142| RP:SCP:NREP 1 RP:SCP:REP 334->431|1brwA3|8e-13|14.9|94/103|d.41.3.1| HM:SCP:REP 315->431|1qwyA_|1.3e-11|37.3|102/270|b.84.3.2|1/1|Duplicated hybrid motif| OP:NHOMO 20 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2111-------------------------2-1---1-11--22---31------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------- STR:NPRED 276 STR:RPRED 44.8 SQ:SECSTR ##############################EETTT#EEEEEEEEc####ccccccTTcEEEETTEEEEccEEcccccEEEE###EEEEcGGGGGGGcEE##################################################################cccHHHHHHHHHHTcE####EEccccHHHHHHHHHHHcccEEccGGGccGGGcEEEEEEEEEEETTEEEEEEEE#################################################HHHHHccccccccccccEEEEEEcTTTccGGGTTcGGGcccccETEEEEEccccEEEEEEcHHHHHHHHHHHTTccccTTccccTTcEEEEcccTTcEEcTTcEEEEEEEccEEEccccHHHHHHHHTTEEEEcccccccccEEc####################################################################################################################################################################################### DISOP:02AL 1-2,116-141,438-451| PSIPRED ccccEEEEEccHHHHHccccccccccEEEEEEEEEEEEEEEEEEEccccEEEEEcccEEEEEEccEEEEEEEcccccccEEEEEEEEEEEEEEEEccEEEcccccccccccccccEEccccccccccccccccccccccccccEEEEEEEccccccccccccEEEEHHHHHHHHHHcccccEEEEEEcccccccHHHcccccHHHHHHHHHHccccEEEEEcccEEEEEEccccccccccEEEEEccccccEEEEcHHHHHHHHHHccccEEEEEEcccEEEEEEEEEcccccccccccccccEEEEcccccccccccccEEccEEEccccccccEEEEEcccEEEEEEEccccEEEEEEEccccEEEEEEEEccccccccccccEEEcccEEEEEcccEEEEEEEEcccEEcccccccccccccccHHHHHcccccccccccccccccccccEEEEEccEEEccHHHHHHHccccccccccccEEcHHHHHHHHHHHccccccEEEEEEEEcEEEcccccEEEEEEcccccEEEEEEEEEEEccEEEEcccccEEEcccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccHHHcccHHHHHHHHHHHHcc //