[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99611.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:133 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   63->115 PF05397 * Med15_fungi 0.00016 18.9 53/115  
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99611.1 GT:GENE ABD99611.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 823123..823524 GB:FROM 823123 GB:TO 823524 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99611.1 GB:DB_XREF GI:90820972 LENGTH 133 SQ:AASEQ MKQVYFYDENKKFVSYDVIDDTAEIPANATAVKPVDSNGVGLYDPTWNESTHSWDSLTENEWKKKYTIPEVKPVPTQEEQAAAQQMLAVADLQGKVVTLTSTVDKLSKSNNELNATLAQIMLQNATNAKNGGK GT:EXON 1|1-133:0| COIL:NAA 26 COIL:NSEG 1 COIL:REGION 90->115| SEG 77->93|qeeqaaaqqmlavadlq| HM:PFM:NREP 1 HM:PFM:REP 63->115|PF05397|0.00016|18.9|53/115|Med15_fungi| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,126-134| PSIPRED ccEEEEEcccccEEEEEEccccccccccccEEEEccccccEEEcccccccccccccccHHHHHHccccccccccccHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHcccHHHHHHHHHHHHcccccccccc //