[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99612.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:60 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->43 PF09693 * Phage_XkdX 3.9e-19 51.3 39/40  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99612.1 GT:GENE ABD99612.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 823526..823708 GB:FROM 823526 GB:TO 823708 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99612.1 GB:DB_XREF GI:90820973 LENGTH 60 SQ:AASEQ MRYSYDIVKRFYDLGLFTKENVQLFVRVNYFTQEDYYKMFPEDKPAETTTSTQPTVAPTA GT:EXON 1|1-60:0| SEG 45->59|paetttstqptvapt| HM:PFM:NREP 1 HM:PFM:REP 5->43|PF09693|3.9e-19|51.3|39/40|Phage_XkdX| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,53-61| PSIPRED cccHHHHHHHHHHHcccccccEEEEEEEEEccHHHHHHHccccccccccccccccccccc //