[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99615.1
DDBJ      :             Phage lysin
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  188/915 : Eukaryota  4/199 : Viruses  6/175   --->[See Alignment]
c.1.8d.7.1
:422 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   56->207 1obaA PDBj 2e-09 32.0 %
:BLT:PDB   379->422 1e01A PDBj 3e-04 47.6 %
:RPS:PDB   314->387 2djpA PDBj 9e-15 20.8 %
:RPS:PDB   378->422 1e01A PDBj 3e-10 42.2 %
:RPS:SCOP  30->209 1h09A2  c.1.8.8 * 8e-14 24.6 %
:RPS:SCOP  324->370 1e0gA  d.7.1.1 * 4e-12 33.3 %
:RPS:SCOP  378->422 1e0gA  d.7.1.1 * 1e-10 42.2 %
:HMM:SCOP  29->227 1h09A2 c.1.8.8 * 1.9e-27 28.2 %
:HMM:SCOP  324->373 1e0gA_ d.7.1.1 * 2e-11 45.8 %
:HMM:SCOP  377->422 1y7mA2 d.7.1.1 * 1.5e-10 51.1 %
:RPS:PFM   328->368 PF01476 * LysM 2e-05 57.5 %
:RPS:PFM   380->422 PF01476 * LysM 4e-05 54.5 %
:HMM:PFM   68->214 PF01183 * Glyco_hydro_25 1.9e-34 37.6 141/181  
:HMM:PFM   328->370 PF01476 * LysM 2.4e-18 50.0 42/44  
:HMM:PFM   380->422 PF01476 * LysM 1.4e-14 42.9 42/44  
:BLT:SWISS 56->207 LYS_BPCP9 9e-10 32.0 %
:BLT:SWISS 328->420 SLE1_STAS1 1e-19 56.0 %
:TM
:REPEAT 2|314->367|368->419
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99615.1 GT:GENE ABD99615.1 GT:PRODUCT Phage lysin GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 824401..825669 GB:FROM 824401 GB:TO 825669 GB:DIRECTION + GB:PRODUCT Phage lysin GB:NOTE COG1388 [M] FOG: LysM repeat GB:PROTEIN_ID ABD99615.1 GB:DB_XREF GI:90820976 LENGTH 422 SQ:AASEQ MKKKKILITLATCAALFFSVQLNTPSVQAARGDHGVDAAVFQGASGKWGYARDKFMISQIGGTTTGWNLYDQWTYPTQVSSTIAQGKRAHTYIWWQNVTSNSQADYVLNYFLPKIQTPKGSIVALDVESGYQNTQAIAHAIQRIKDAGYTPMLYGYKNYLVNNTDLSYLSTLCQLWLAEYPNYAVTPEPNYNYFPSFNNIGIFQFTSTYVAGGLDGDIDLTGITDNGYKNGNPEKPKTHTPAVDAGIKADNTPKRDITVGYTVKVNYSASRWATGQYIPSFIKGNFYKVIQVSSNKVLLDGVMSWINKSDVEILQTTAPVQSNNSSYYTVRYGDTLGGIAYRYGTTWQNLQALNGLSNPNWIYPGQRLKVTGSVSTQQTYTVRYGDTLSGIAYRYGVNVYALARNNGISNINWIYPGQRLII GT:EXON 1|1-422:0| BL:SWS:NREP 2 BL:SWS:REP 56->207|LYS_BPCP9|9e-10|32.0|147/339| BL:SWS:REP 328->420|SLE1_STAS1|1e-19|56.0|91/327| TM:NTM 1 TM:REGION 6->27| NREPEAT 1 REPEAT 2|314->367|368->419| SEG 212->225|ggldgdidltgitd| BL:PDB:NREP 2 BL:PDB:REP 56->207|1obaA|2e-09|32.0|147/338| BL:PDB:REP 379->422|1e01A|3e-04|47.6|42/48| RP:PDB:NREP 2 RP:PDB:REP 314->387|2djpA|9e-15|20.8|72/77| RP:PDB:REP 378->422|1e01A|3e-10|42.2|43/48| RP:PFM:NREP 2 RP:PFM:REP 328->368|PF01476|2e-05|57.5|40/44|LysM| RP:PFM:REP 380->422|PF01476|4e-05|54.5|42/44|LysM| HM:PFM:NREP 3 HM:PFM:REP 68->214|PF01183|1.9e-34|37.6|141/181|Glyco_hydro_25| HM:PFM:REP 328->370|PF01476|2.4e-18|50.0|42/44|LysM| HM:PFM:REP 380->422|PF01476|1.4e-14|42.9|42/44|LysM| GO:PFM:NREP 2 GO:PFM GO:0016998|"GO:cell wall macromolecule catabolic process"|PF01476|IPR018392| GO:PFM GO:0016998|"GO:cell wall macromolecule catabolic process"|PF01476|IPR018392| RP:SCP:NREP 3 RP:SCP:REP 30->209|1h09A2|8e-14|24.6|171/189|c.1.8.8| RP:SCP:REP 324->370|1e0gA|4e-12|33.3|45/48|d.7.1.1| RP:SCP:REP 378->422|1e0gA|1e-10|42.2|43/48|d.7.1.1| HM:SCP:REP 29->227|1h09A2|1.9e-27|28.2|181/0|c.1.8.8|1/1|(Trans)glycosidases| HM:SCP:REP 324->373|1e0gA_|2e-11|45.8|48/48|d.7.1.1|1/2|LysM domain| HM:SCP:REP 377->422|1y7mA2|1.5e-10|51.1|45/0|d.7.1.1|2/2|LysM domain| OP:NHOMO 234 OP:NHOMOORG 198 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------1-----11121---------1-----------1--------1--------------------------------------------111--1---------1------------1111----------1-----1-----1-11-----1-------11--------22-----12311-3------1-1-111111111111111111411-22-11221-1121122111-31-2---1---------------1-----1---11--------------1---------------1---1----2---2--1-1-4--2333-------1-------------------------------------------------------------------------------------1-1-----------------------------------------------------------------------------------------------------------11-------------------------1------------------------------11-1-----------------------------1---------1-1-1111111111111-11111111111111111111131111-111111-111111111-11111111-111111111111---------------------------------111111---1-1------------------------------------------------------------------------------------------------------------------ -------------1--1---------------------------------------------------------------------------1--------------------------------------------------------------------------------------------2------------- -----------------------------------------------------------------------1----------------------------1---------------1-----------------111-------------------------------------- STR:NPRED 257 STR:RPRED 60.9 SQ:SECSTR #######################################################HHHHHTccEEEEEEEETTTEEcTHHHHHHTcEEEEEEEEcccTTcHHHHHHHHHHHHTTccccccEEEEEEcccHHHHHHHHHHHHHHHHHTTcEEEEEEEHHHHHHHcc##HHHHHTTEEEEccTTcccc##ccGGGccccTTEEEEEEEc##########################################################################################################cccccccccEEEEEEcccTTccHHHHHHHHTccHHHHHHHHTccccccGGGcccEEEcHEEEcccccccccccccccHHHHHHHHHHHHHTTccccccccccHHHHHTc DISOP:02AL 1-3,245-250,307-325| PSIPRED cccHHHHHHHHHHHHHHHHEEcccccccHHcccccEEEEEEcccHHHHHHccccEEEEEEEEccccccccccccHHHHHHHHHHcccEEEEEEEEEccccHHHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHHHcccEEEEEccHHHHHHHccccHHcccccEEEEcccccccccccccccccccccEEEEEEcccEEEccccccEEEEEEEccccccccccccccccccccccccccccccccEEEEEEEEEcccHHHHHHHccccHHHHHHHHccccccHHHEEEcccEEcccccccccccccccccccccEEEEEEccccHHHHHHHHcccHHHHHHHcccccHHHcccccEEEEEEEccccccccccccccHHHHHHHHcccHHHHHHHcccccccEEccccEEEc //