[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99616.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:53 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99616.1 GT:GENE ABD99616.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 826208..826369 GB:FROM 826208 GB:TO 826369 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99616.1 GB:DB_XREF GI:90820977 LENGTH 53 SQ:AASEQ MEDFKSCREIILLDILYCTFRMASFTYMVTWAYFYCSYRWNILSGQKLISMRN GT:EXON 1|1-53:0| TM:NTM 1 TM:REGION 7->29| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,52-54| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEccHHHHHccc //