[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99625.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  746/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:379 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   103->373 2r1fA PDBj 9e-19 31.8 %
:RPS:PFM   63->370 PF02618 * YceG 3e-53 42.2 %
:HMM:PFM   63->370 PF02618 * YceG 2.3e-90 38.0 287/295  
:HMM:PFM   13->35 PF04888 * SseC 0.0006 50.0 22/306  
:HMM:PFM   25->84 PF05814 * DUF843 0.00081 22.8 57/83  
:BLT:SWISS 70->373 YCEG_ECOLI 3e-26 34.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99625.1 GT:GENE ABD99625.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 832807..833946 GB:FROM 832807 GB:TO 833946 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:NOTE COG1427 [R] Predicted periplasmic solute-binding protein GB:PROTEIN_ID ABD99625.1 GB:DB_XREF GI:90820986 LENGTH 379 SQ:AASEQ MKNDNTNYPSRSEKLKKQRGIASKMVSWIVGILVVLVVLMGVMGYKYIHSSLQPLNANNTKKVEVKIPIGSSNKQIGDILEKNNIIKSGIVFDYYVKTNKVGNFKAGYYQLSPSMTLDEIAKELQQGGQSNLHSNGTILIKEGASIDQVADVVQKNTKFKKQDFLKLMNDANFLNELKNKYPQLLSSAVDAKDTKYKLEGYLYPATYTVGKHDNLKAVVEQMVAKTNMEMKPYFDKISKSKYSVQQVLTLASLVEKEYGSADDRGKIAGVFENRLEQDMPLQSDVAIHYALNNSKSTVSYDDLEVDSPYNLYKNKGLGPGPFNNPSIDSVKAVLNPVDKDKGYLYFVANIKTKKVYFSKTYAEHQKNVKKLQKANGYEN GT:EXON 1|1-379:0| BL:SWS:NREP 1 BL:SWS:REP 70->373|YCEG_ECOLI|3e-26|34.1|273/340| TM:NTM 1 TM:REGION 23->45| SEG 29->44|ivgilvvlvvlmgvmg| BL:PDB:NREP 1 BL:PDB:REP 103->373|2r1fA|9e-19|31.8|242/252| RP:PFM:NREP 1 RP:PFM:REP 63->370|PF02618|3e-53|42.2|287/291|YceG| HM:PFM:NREP 3 HM:PFM:REP 63->370|PF02618|2.3e-90|38.0|287/295|YceG| HM:PFM:REP 13->35|PF04888|0.0006|50.0|22/306|SseC| HM:PFM:REP 25->84|PF05814|0.00081|22.8|57/83|DUF843| OP:NHOMO 756 OP:NHOMOORG 748 OP:PATTERN -------------------------------------------------------------------- 1111311111111111111-11111111111111111111111111111111111111111111111222111111111111111111111111111--11111112111---------------1111111111111111---111--1---11--------1--1---1------------111111111111111112111111111111111111111111111111111-------------------1-1-11--1-111--1111111-1111111111111111111111-11111111111111111111111111111111111111111111111-11--1--1111111111111111-1111-111111111111111111111111111111111-11111111111111111111111111111-1111111111111111111111111------------1111111111111-----111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111112-1111111111111111111111111111111--11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111---------1111111111111-111111111111111--111111111111111111--------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 242 STR:RPRED 63.9 SQ:SECSTR ######################################################################################################ccccccccccTT#cHHHH#HHHHHcccccE####EEEccTT################cHHHHHHHHHccTTccccccccHHHHHHHHTcccTTc#cTTcccccEEcTTccH##HHHHHHHHHHHHHHHHHHHTccTTcccccHHHHHHHHHHHHHcccGGGHHHHHHHHHHHHHHTc#cccHHHHHHHGGGccccccHHHHHcccTTcTTTcccccccccccccHHHHHHHHcccccc##ccEEEEcccccEE#EEccHHHHHHHHHHHHH###### DISOP:02AL 1-23,372-372,375-380| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEHHccccccccccccEEEEEEcccccHHHHHHHHHHccccccHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHcccccccccccEEEEcccccHHHHHHHHHHcccccHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccccHHHHcccccccccccccccccccccccHHHHHHHHccccccccEEEEEEEccccEEEEcccHHHHHHHHHHHHHHHcccc //