[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99634.1
DDBJ      :             Phosphoglycolate phosphatase
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  181/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:204 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->180 2fi1A PDBj 2e-32 39.4 %
:RPS:PDB   2->203 3d6jA PDBj 1e-26 23.9 %
:RPS:SCOP  3->204 2hdoA1  c.108.1.6 * 6e-32 20.6 %
:HMM:SCOP  1->206 2hdoA1 c.108.1.6 * 2.2e-40 26.3 %
:RPS:PFM   20->162 PF00702 * Hydrolase 1e-07 29.3 %
:HMM:PFM   4->174 PF00702 * Hydrolase 4e-24 25.9 170/192  
:BLT:SWISS 4->174 PPAX_CLOPE 4e-14 30.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99634.1 GT:GENE ABD99634.1 GT:PRODUCT Phosphoglycolate phosphatase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 841697..842311 GB:FROM 841697 GB:TO 842311 GB:DIRECTION + GB:PRODUCT Phosphoglycolate phosphatase GB:NOTE COG0546 [R] Predicted phosphatases GB:PROTEIN_ID ABD99634.1 GB:DB_XREF GI:90820995 LENGTH 204 SQ:AASEQ MKYKNYFWDFDGTLYNSYPGMVRAFVETLKTQEIELDSKEVYKIMREASVRKAFKLYGENLDIPKLRQMYHSFEEQYQDKMSLFDGVADVCRKIKENGGRNFLLTHRDSSALNILKRDNLWSYFDDFVTADNDFARKPDPESLLYLVNKYNLKVEESVMVGDRELDIAAGHNAGMSGILFDPDKLLHQDYNADRLVYSLSDILK GT:EXON 1|1-204:0| BL:SWS:NREP 1 BL:SWS:REP 4->174|PPAX_CLOPE|4e-14|30.6|170/214| BL:PDB:NREP 1 BL:PDB:REP 1->180|2fi1A|2e-32|39.4|175/187| RP:PDB:NREP 1 RP:PDB:REP 2->203|3d6jA|1e-26|23.9|201/206| RP:PFM:NREP 1 RP:PFM:REP 20->162|PF00702|1e-07|29.3|133/195|Hydrolase| HM:PFM:NREP 1 HM:PFM:REP 4->174|PF00702|4e-24|25.9|170/192|Hydrolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00702|IPR005834| GO:PFM GO:0008152|"GO:metabolic process"|PF00702|IPR005834| RP:SCP:NREP 1 RP:SCP:REP 3->204|2hdoA1|6e-32|20.6|199/207|c.108.1.6| HM:SCP:REP 1->206|2hdoA1|2.2e-40|26.3|205/0|c.108.1.6|1/1|HAD-like| OP:NHOMO 240 OP:NHOMOORG 185 OP:PATTERN ----1---------------------------------------------------1----1-1---- -1--------------------------------------------1-------------------------------1-----111---1-----------------------------------------------------------------------------------------------------1-222222241322323-111-1331-11--1-1--21---111111111111111-------2-11--1--11--221211--22122222223232222221222211111111111113111111111---11-------1-11----1111-1-1-11--------1-1---1-----1---------------------------------------------------1---1-----1----------------------1----------------------------------------11112-------------1----------------------11------1---1-------------------------1--------------1------1---1-------1-----------1-1------1--1-----------------11-11---------------11--------------------------------------1------------------1---------------------------------------111--------------------------------1-----1111-----------1-11111-1111-----------------1---------------------------------------111-1----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 204 STR:RPRED 100.0 SQ:SECSTR ccccEEEEcccTTTEEcHHHHHHHHHHHHHHTTcccccHHHHTTTHHHHHHHHHccccHHGHHHHHHHHHHHHHHHHGGGcEEcTTHHHHHHHHHHHTcEEEEEccccHHHHHHHHHTccTTcccEEEcGGGccccTTcTHHHHHHHHHTTccGGGEEEEEccHHHHHHHHHHTcEEETTcccTTGGGGccccEEEccGGGGcH PSIPRED ccccEEEEcccccccccHHHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccEEEEEEcccHHHHHHHHHcccHHHccEEEEHHHcccccccHHHHHHHHHHccccHHHEEEEEccHHHHHHHHHcccEEEEEccccccHHHHcccEEEccHHHHcc //