[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99642.1
DDBJ      :             Transcriptional regulators, LysR family
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  578/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:318 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->153 3hhgG PDBj 6e-08 22.0 %
:RPS:PDB   1->217 1b9nB PDBj 2e-24 11.0 %
:RPS:SCOP  1->109 1b9mA1  a.4.5.8 * 1e-18 14.7 %
:RPS:SCOP  95->305 1utbA  c.94.1.1 * 4e-17 13.1 %
:HMM:SCOP  9->120 1b9mA1 a.4.5.8 * 1.7e-18 29.5 %
:HMM:SCOP  94->303 2fyiA1 c.94.1.1 * 7.8e-23 19.1 %
:RPS:PFM   12->69 PF00126 * HTH_1 5e-10 43.1 %
:RPS:PFM   95->296 PF03466 * LysR_substrate 5e-05 21.3 %
:HMM:PFM   96->301 PF03466 * LysR_substrate 1.7e-24 17.9 201/209  
:HMM:PFM   13->69 PF00126 * HTH_1 2e-19 49.1 57/60  
:BLT:SWISS 11->296 CYNR_ECO57 2e-19 25.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99642.1 GT:GENE ABD99642.1 GT:PRODUCT Transcriptional regulators, LysR family GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 850307..851263 GB:FROM 850307 GB:TO 851263 GB:DIRECTION + GB:PRODUCT Transcriptional regulators, LysR family GB:NOTE COG0583 [K] Transcriptional regulator GB:PROTEIN_ID ABD99642.1 GB:DB_XREF GI:90821003 LENGTH 318 SQ:AASEQ MKTKQENIFSSKTLSYFLQLAETMSYTQAAQILGITQPALTQQIKKLERTVGAPLFYSVGKKLHLSDAGYTMLDATHQIYETLNQATDEIQMSTSATQGEINIGILASIEDSVISQFATAYYRKHNGIKLTTHMLTRKEIWERLENNTIDLAVMYLPDESIKNWKPYESKRICQEDLIFLHNDNKIKQKKINLKDTLQHPWVTYPPEYYLNESISEAYKNAMLDAPNSVSYFATPGQIFNFAAQTGVCTALPMSFVVAHNQDGIMKQALLEPGISFDLSFVFRKGKDQIPRISNFLKEIDNYLREEDYISRLTKINKK GT:EXON 1|1-318:0| BL:SWS:NREP 1 BL:SWS:REP 11->296|CYNR_ECO57|2e-19|25.1|279/299| BL:PDB:NREP 1 BL:PDB:REP 10->153|3hhgG|6e-08|22.0|141/294| RP:PDB:NREP 1 RP:PDB:REP 1->217|1b9nB|2e-24|11.0|209/245| RP:PFM:NREP 2 RP:PFM:REP 12->69|PF00126|5e-10|43.1|58/60|HTH_1| RP:PFM:REP 95->296|PF03466|5e-05|21.3|197/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 96->301|PF03466|1.7e-24|17.9|201/209|LysR_substrate| HM:PFM:REP 13->69|PF00126|2e-19|49.1|57/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 1->109|1b9mA1|1e-18|14.7|109/122|a.4.5.8| RP:SCP:REP 95->305|1utbA|4e-17|13.1|206/214|c.94.1.1| HM:SCP:REP 9->120|1b9mA1|1.7e-18|29.5|105/0|a.4.5.8|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 94->303|2fyiA1|7.8e-23|19.1|204/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 2177 OP:NHOMOORG 584 OP:PATTERN -------------------------------------1------------------------------ 242-2---3321-1412----2---5------223235EC-311--11-----322-2--231--2E4632------1-143311-1-1111-------11411-411-3---------------1---1----1-13311---1131231132211------22186252------------111-----3297777778736566963186867572326231344444FK122222222222222333361222232-323552212134---1-1111-----22------------111--1111111---------1-2-94-------2-324221111311-1214-14513--1-3-------21122111------15343224642233423343346---3--22446-154444368A574682--426121233-111111112212-122-------------------------------21--4DC9ADABDCE44444BBIL544645FAHBFAH-187245262C2B1D94424---2--------11112221--1---1-211--1-1223111112123-1--1--1111---------------144425--25223433342-1433322454224---1113------63761656654643566-6656644666645665664CEB341374343445453435334745333351-743444333444---2-----22221243G---1-1-1111-11-4444523121D18879A98A7ACA83788---------51333666661543325334331111-----12--------------1-------------------------------------221 -------------1------------------------------------------------------------------------------------------------------------------------------------------------4------1----------------------2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 313 STR:RPRED 98.4 SQ:SECSTR EEETTEEEEcHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTccccEcTTccccccHHHHHHHHHHHHHHHHHHHHHHHHHcTTccccccHHHHHHTTTcHHccccccEEEEEEEcccEEEEEETTcccEEEEEccHHHHHHHTccTTcEEEEEEcGGGcEEEccHHHHTcEEEEEEEEEEEEcccEEEEEEEcTTccEEEEEEEGGHHHHHTcccEEEEEEccHHHHHHHHHHTccEEEEEGGGccTTTcTTcEEEEccTTcccEEEEEEEETTccccHHHHHHHHHHcTTccHHcccEEEE##### DISOP:02AL 1-6,93-94,306-319| PSIPRED ccccHHccccHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccEEEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccccEEEEEcccccccccccEEEEEEEcccEEEEccccccccccccHHHHccccEEEcccccHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHccEEEEccHHHHHHHccccEEEEEccccccEEEEEEEEcccccccHHHHHHHHHHHHHHccccHHHHHHHHHcc //