[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99647.1
DDBJ      :             Hypothetical secreted protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:228 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->57 PF06474 * MLTD_N 1.5e-05 29.8 47/95  
:HMM:PFM   115->148 PF00034 * Cytochrom_C 0.00032 57.1 28/91  
:BLT:SWISS 184->227 FAMA_ARATH 4e-04 46.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99647.1 GT:GENE ABD99647.1 GT:PRODUCT Hypothetical secreted protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 855420..856106 GB:FROM 855420 GB:TO 856106 GB:DIRECTION + GB:PRODUCT Hypothetical secreted protein GB:PROTEIN_ID ABD99647.1 GB:DB_XREF GI:90821008 LENGTH 228 SQ:AASEQ MKKVIYLGITMLSAMVLVGCSNTSSAPNTTSHSSNVKTEVKSSSTSKKEKKITAKAVDESSVVAESSSVDSNNNNSVSTNSNVQTATNQVASANSSVAKESSSVATGNNNVTENAVAPSVAAESSQKVQEVNQQLTPAQIAALAAYYMGNDANSLTVHNMGNYNAVSGADGQLLFAYSADGNNLKVGGFGDTPWDSVNANDVMQKAQQQGNKDSINQVANNTTFEKGY GT:EXON 1|1-228:0| BL:SWS:NREP 1 BL:SWS:REP 184->227|FAMA_ARATH|4e-04|46.5|43/100| SEG 33->51|ssnvktevkssstskkekk| SEG 57->105|vdessvvaesssvdsnnnnsvstnsnvqtatnqvasanssvakesssva| HM:PFM:NREP 2 HM:PFM:REP 11->57|PF06474|1.5e-05|29.8|47/95|MLTD_N| HM:PFM:REP 115->148|PF00034|0.00032|57.1|28/91|Cytochrom_C| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,25-55,64-80,88-108,121-132,203-217,222-224,226-229| PSIPRED ccEEEEEEHHHHHHHHHHccccccccccccccccccEEEEccccccHHHHHHHHHHcccccEEEccccccccccccEEcccccHHHHHHHHccccHHHHccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccEEEEEEccccccccccccEEEEEEEcccccEEEccccccccccccHHHHHHHHHHHccHHHHHHHHccccccccc //