[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99650.1
DDBJ      :             Ribonuclease HI / Cell wall enzyme EBSB
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.3
:128 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   3->121 3d0pA PDBj 2e-07 19.0 %
:RPS:SCOP  2->81 1f21A  c.55.3.1 * 1e-06 18.4 %
:HMM:SCOP  1->123 1zbfA1 c.55.3.1 * 5.9e-17 26.1 %
:HMM:PFM   3->98 PF00075 * RnaseH 1.7e-12 26.1 88/131  
:BLT:SWISS 1->127 EBSB_ENTFA 2e-20 37.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99650.1 GT:GENE ABD99650.1 GT:PRODUCT Ribonuclease HI / Cell wall enzyme EBSB GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(858179..858565) GB:FROM 858179 GB:TO 858565 GB:DIRECTION - GB:PRODUCT Ribonuclease HI / Cell wall enzyme EBSB GB:PROTEIN_ID ABD99650.1 GB:DB_XREF GI:90821011 LENGTH 128 SQ:AASEQ MLKIYTDAATNQKNHTFAAGILIVKNQQQTQLKYEISATDNHEAEFIAAIHGFNYLIENFPDEDLVFFYSDSKILIDSLEKQYSKSYSQTLADLLALQENFPIVINNWISDKENAGAHTLAIQALHEH GT:EXON 1|1-128:0| BL:SWS:NREP 1 BL:SWS:REP 1->127|EBSB_ENTFA|2e-20|37.0|127/135| RP:PDB:NREP 1 RP:PDB:REP 3->121|3d0pA|2e-07|19.0|116/134| HM:PFM:NREP 1 HM:PFM:REP 3->98|PF00075|1.7e-12|26.1|88/131|RnaseH| RP:SCP:NREP 1 RP:SCP:REP 2->81|1f21A|1e-06|18.4|76/152|c.55.3.1| HM:SCP:REP 1->123|1zbfA1|5.9e-17|26.1|119/0|c.55.3.1|1/1|Ribonuclease H-like| OP:NHOMO 41 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1---11-----1--------1----------1111111111111111111-1-1-11-1---11111111-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 95.3 SQ:SECSTR ##cEEEEEEEccccEEEEEEEEETTTccEEEEEEEEEEEcHHHHHHHHHHHHHHHHHHTTccTccccEEEccHHHHHHHHHTccccccHHHHHHHHHHHHHccccccEEEccHHHHcccTTHHH#### DISOP:02AL 126-129| PSIPRED cEEEEEcccccccccccEEEEEEEcccEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEcHHHHHHHHcccccccHHHHHHHHHHHHHcccEEEEEEEEHHHcHHHHHHHHHHHHHc //