[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99651.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->60 PF09913 * DUF2142 0.00011 28.3 46/389  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99651.1 GT:GENE ABD99651.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 858592..858966 GB:FROM 858592 GB:TO 858966 GB:DIRECTION + GB:PRODUCT Hypothetical membrane spanning protein GB:PROTEIN_ID ABD99651.1 GB:DB_XREF GI:90821012 LENGTH 124 SQ:AASEQ MNKKYFYQPDIPVSISCWSFTLMILLFSLLLWLEITVFQIWTVITFIIFVLVALIQVLLRKVELSDTELSFRAVIPFNNFKIKKVDIKEIEIRKYGLFIKTKYRDYRLIVSKEVAENAYNNMAK GT:EXON 1|1-124:0| TM:NTM 2 TM:REGION 13->35| TM:REGION 38->59| SEG 22->33|lmillfslllwl| SEG 81->94|kikkvdikeieirk| HM:PFM:NREP 1 HM:PFM:REP 13->60|PF09913|0.00011|28.3|46/389|DUF2142| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,118-118,121-125| PSIPRED ccccEEEcccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccEEEEEEEEEEEEEEEEEEEEEccEEEEEEEEHHHHHHHHHHHcc //