[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99655.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->73 PF04797 * Herpes_ORF11 7.2e-05 15.0 60/389  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99655.1 GT:GENE ABD99655.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 863061..863291 GB:FROM 863061 GB:TO 863291 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99655.1 GB:DB_XREF GI:90821016 LENGTH 76 SQ:AASEQ MYIETYFIKLKIMLEICNSFRNHDTVDIQNCSSKMKTAVTLDVKFTSKETRRNRKDILVHYVLYLIYEIYQKRITK GT:EXON 1|1-76:0| HM:PFM:NREP 1 HM:PFM:REP 14->73|PF04797|7.2e-05|15.0|60/389|Herpes_ORF11| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 75-77| PSIPRED ccEEEEEHHHHHHHHHHHHHcccccEEHHHHHHccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //