[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99656.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  203/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:232 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->232 3gnlA PDBj 8e-50 45.3 %
:RPS:SCOP  20->121 1f38A  c.66.1.22 * 1e-04 19.2 %
:HMM:SCOP  4->142 1r18A_ c.66.1.7 * 8.6e-07 18.7 %
:RPS:PFM   23->215 PF04816 * DUF633 7e-44 49.2 %
:HMM:PFM   23->227 PF04816 * DUF633 5.6e-76 51.7 203/205  
:BLT:SWISS 23->231 YQFN_BACSU 1e-43 44.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99656.1 GT:GENE ABD99656.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 864752..865450 GB:FROM 864752 GB:TO 865450 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:NOTE COG2384 [R] Predicted SAM-dependent methyltransferase GB:PROTEIN_ID ABD99656.1 GB:DB_XREF GI:90821017 LENGTH 232 SQ:AASEQ MDGNKLSYRLQKVAEYVPADSRLADIGSDHAYLPAYLALKGKINFGIAGEVVKGPFQNAQNEIKKENLQEIIDVRLADGLAAVELSDEINVVTICGMGGPLICQILEEGKAKLANHPRLVLQPNVGEKNVREWLVANNYQIIAEDVLEEDRHIYEIIVAEFVDAKAELTAKELEFGPYLMKEKNEVFKHKWQKELDKIETVRVQLEKAKEKPVAKLEYLDEQVKLIEGVLND GT:EXON 1|1-232:0| BL:SWS:NREP 1 BL:SWS:REP 23->231|YQFN_BACSU|1e-43|44.2|208/216| BL:PDB:NREP 1 BL:PDB:REP 5->232|3gnlA|8e-50|45.3|225/232| RP:PFM:NREP 1 RP:PFM:REP 23->215|PF04816|7e-44|49.2|193/203|DUF633| HM:PFM:NREP 1 HM:PFM:REP 23->227|PF04816|5.6e-76|51.7|203/205|DUF633| RP:SCP:NREP 1 RP:SCP:REP 20->121|1f38A|1e-04|19.2|99/186|c.66.1.22| HM:SCP:REP 4->142|1r18A_|8.6e-07|18.7|134/223|c.66.1.7|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 203 OP:NHOMOORG 203 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1111-111----------------------------------------------------------1----1---1--11----11---111------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 225 STR:RPRED 97.0 SQ:SECSTR ####cccHHHHHHHTTccccEEEEEETccTTHHHHHHHHTTcEEEEEEEEccHHHHHHHHHHHHHTTcTTTEEEEEccGGGGccGGGcccEEEEEE#cHHHHHHHHHHTGGGGTTccEEEEEEcccHHHHHHHHHHHTEEEEEEEEEEETTEEEEEEEEE#ccccccccHHHHHHcHHHHHHccHHHHHHHHHHHHHHHHHHTcccccHHHH#HHHHHHHHHHHHHHHHHTc DISOP:02AL 1-4,205-213,232-233| PSIPRED ccHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHccccccEEEEEccccccccccccccEEEEEcccHHHHHHHHHHcHHHHccccEEEEcccccHHHHHHHHHHcccEEEEEEEEEEccEEEEEEEEEcccccccccHHHHHHcHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcc //