[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99668.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   50->73 PF11174 * DUF2970 2.1e-05 45.8 24/56  
:HMM:PFM   5->60 PF05135 * Phage_QLRG 0.00037 16.1 56/102  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99668.1 GT:GENE ABD99668.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 878489..878710 GB:FROM 878489 GB:TO 878710 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99668.1 GB:DB_XREF GI:90821029 LENGTH 73 SQ:AASEQ MDEKPQLRRRNKVDDVQEDSELEGLSRTGSRKLRESNEENYKKNRLKARLNMIIAGLILAIIIVYLIMFFVNF GT:EXON 1|1-73:0| TM:NTM 1 TM:REGION 49->71| SEG 53->67|iiaglilaiiivyli| HM:PFM:NREP 2 HM:PFM:REP 50->73|PF11174|2.1e-05|45.8|24/56|DUF2970| HM:PFM:REP 5->60|PF05135|0.00037|16.1|56/102|Phage_QLRG| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-44| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //