[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99678.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:94 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99678.1 GT:GENE ABD99678.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 891718..892002 GB:FROM 891718 GB:TO 892002 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99678.1 GB:DB_XREF GI:90821039 LENGTH 94 SQ:AASEQ MEYSKKETEEWLRGGELPDKSTKLGIKEYIFDDVTLTLDKNLHPTIRSSKSIKLKLLEFKYEYHSSKGENVVMLRLSYQQGKEVVRITKEIIGK GT:EXON 1|1-94:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-10| PSIPRED ccccHHHHHHHHHcccccccHHcccHHHHEEccEEEEEcccccccccccccEEEEEEEEEEEEccccccEEEEEEEEcHHcHHHHHHHHHHHcc //